KEGG   Mus musculus (mouse): 67534
Entry
67534             CDS       T01002                                 

Gene name
Ttll4, 4632407P03Rik, AI451681, mKIAA0173
Definition
(RefSeq) tubulin tyrosine ligase-like family, member 4
  KO
K16601  tubulin polyglutamylase TTLL4 [EC:6.-.-.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    67534 (Ttll4)
Enzymes [BR:mmu01000]
 6. Ligases
  6.-  
   6.-.-  
    6.-.-.-  
     67534 (Ttll4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Tubulin modification proteins
     Tubulin polyglutamylases
      67534 (Ttll4)
SSDB
Motif
Pfam: TTL ATPgrasp_YheCD ATPgrasp_ST
Other DBs
NCBI-GeneID: 67534
NCBI-ProteinID: NP_001014974
MGI: 1914784
Ensembl: ENSMUSG00000033257
Vega: OTTMUSG00000021753
UniProt: Q80UG8
Position
1; 1 C4
AA seq 1193 aa
MASAGTEHYSIGLRRGNSFKQRHPSGTVSASPSEKPSEVKVWSQAHQQVKPIWKLEKKHV
GTLSAGLGTSFLGVPSQPAYFLCPSTLCSSGTTAVIAGHSNPCYLQSLPNLFSNTLLYRR
TNVRQKPYQQLESFCLRSSPSEKRSFSLPQKGLPVSVTANKATSSTVFPMAQPMATSPTD
PYLSLAAAGENPSRKSLASAISGKIASPLSYKPMLNNNSFMRPNSTKVPLSQATDGLKPV
SSPKIQPVSWHHSGGTGDCVPQPGDHKVPQNIATVLDDVTAPITPSIPSTLNISTASVTS
SQCSQSNFRMEAHPCGLDENPDSQSATKEVHFTEAVRKLAEKGLEKMPRQGYQFEQACFV
NPSFQWGLLNRSRRWKPLMGQRFPQEDIGLDSAILPGTSDTLGLDSTVFCTKRISIHLLA
SHVHGLNPSPACGSAVDPQVLGEDRAPVPPSSLQPLGVAEVATRLSSVHLDQPGKEPEEA
KDLNSCTKGGGSATDLQPNQVEPEDTEDELGDGLEDSCSHDENEEEEGDSECSSLSVVSP
SESVALISRNCVDLMSKSLPNHEKVVRPALIYSLFPNVTPTIYFGTRDERVEKLPWEQRR
LLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPGFRSIREHQKLNHFPGS
FQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDSKLLRKAWESSSRQKWIVKPPAS
ARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDG
LVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQ
KGINSDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVL
EVNISPSLHSNSPLDISIKGQMIRDLLNLAGFVLPNMEDIISSSSSPSSSSGSSTSLPSS
PRDKCQMTPEHFTAQKMKKAYYLTQKIPDQDFYASVLDVLTPDDVRVLVEMEDEFSRRGQ
FERIFPSRISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKGFHTGIVSD
SAPLWSLPTSLMTTSKGDGTPNSASKSRKKSASEGTTLSSEDRSTPKSKKSQAGLSPISR
KTLSSRSNENTSKQSKRSTPGLPVLKYSGQSSRLSAASASQSVTDSRLTAVSS
NT seq 3582 nt   +upstreamnt  +downstreamnt
atggcctcagcaggaacagagcactacagtattggcctgcgccgaggaaacagcttcaag
cagagacatccctcaggcacagtgtctgcttcaccatctgagaaaccctcggaggtcaaa
gtctggtctcaggcccatcagcaggtgaagccaatctggaaactggaaaagaagcacgta
ggcacactgtcagcagggctgggcaccagtttcttgggagtcccatcccagccagcctat
ttcctttgccctagcactttatgtagctctgggaccacagcagtcattgcaggccacagc
aacccctgttacctgcagtccctccctaacttgttcagcaatactctgctgtaccgccgc
accaacgtgaggcaaaaaccataccagcaactggaatctttctgcttgcgttccagccct
tcagagaaaagatctttttctctccctcagaagggtcttcctgtcagtgtcactgccaat
aaagccacatcttctacagtcttccccatggcccagcccatggcaacttcacccactgat
ccatacctctcactggcagcagctggggagaacccttcaaggaagagcctggcctctgct
atctcagggaagattgcatctccactgtcctataagcccatgctgaacaacaactccttc
atgaggccaaatagcactaaagtgcccttatcacaagccacagatggcctgaagccagta
tcctcacccaagatccagcctgtctcatggcatcattcagggggtactggggactgtgta
ccccaacctggtgaccataaggtgccccaaaacattgctactgtcttagatgatgtcact
gcccctatcaccccatctatccctagcaccctcaacatatccacagccagtgttacctct
tcccagtgcagtcagagtaactttaggatggaggcacatccctgtggcctggatgaaaac
ccggattcccagagtgctactaaagaggtacacttcactgaggctgtgaggaagttggct
gaaaaaggcttggagaagatgccacgacaaggctaccagtttgaacaggcttgttttgtg
aaccccagcttccagtggggtcttctcaacagaagcaggcggtggaaacctctgatgggc
cagcggtttcctcaggaggatattggattagacagtgcgatccttcctggtacttcagac
accttggggttggacagcacagtcttctgtaccaagaggatcagcattcacctccttgcc
tcacatgtccatgggctcaatcccagccctgcctgtgggtctgcagttgacccccaggta
cttggagaagacagagctcctgttcccccttcttccctccagcctcttggtgtagctgaa
gtggccactcgtctttcttctgtccatcttgaccagcctgggaaggagcctgaggaagcc
aaggacctgaactcttgtactaagggtggtggttcagctactgacctccagccaaaccag
gtggagcctgaagatacagaagatgaactgggagatggtttggaagatagctgcagccat
gatgagaatgaagaagaggaaggagactcagagtgctcttctttaagtgttgtctccccc
agcgagtcagtggcattaatatctcggaactgtgtggatttgatgtccaaatcccttccc
aatcatgagaaagttgtacggccagccctcatctacagtctcttccccaatgtaacccct
accatctattttgggactcgggatgaaagagtggagaaacttccttgggaacagaggagg
ctgcttcggtggaagatgagcacagtgacccccaacattgtcaagcagaccatcggtcgg
tcacacttcaaaatcagcaagagaaatgatgactggctgggctgctggggtcaccacatg
aagtctcctggttttcgatccattagagagcatcagaagctaaaccacttcccaggctcc
ttccagattgggaggaaggaccggctgtggcggaacctgtctcgcatgcaaagccgtttt
ggcaagaaggagttcagtttctttcctcagtcctttatcctgccccaggattccaagctc
ttgcgcaaagcctgggagagcagcagccgccagaagtggattgtgaagccaccagcatct
gctcgaggcattggcattcaggtcattcacaaatggagtcagctccccaagcgcaggccc
ctcctggtacagaggtatctacacaagccctacctcattagtggcagcaaatttgatctt
cggatctatgtttacgtgacttcttatgatcctctacggatttacctcttttcggatgga
ctcgtccgttttgccagttgcaagtattccccttccatgaagagtcttagcaacaagttc
atgcacctgaccaactacagtgtcaataaaaagaacacagaataccaggctaatgctgat
gagactgcatgccaagggcacaaatgggcattgaaagctttgtggaactatctgagccag
aaaggaattaatagtgatgccatctgggagaagataaaggatgttgtagtcaaaaccatc
atctcgtcagagccctatgtgactaacctactgaagttatatgtgcggcgcccctatagc
tgtcatgagctctttggttttgacatcatgctggatgagaacctgaaaccctgggtccta
gaagtcaacatttctccaagcctccattccaactctcctctggacatcagcatcaaaggc
cagatgatccgagaccttctgaacctggctggctttgttctgcccaacatggaggatatc
atctctagttccagcagccccagcagctccagcggctccagcaccagcttgccaagctct
cctagagacaaatgtcaaatgactccagagcacttcactgcacagaagatgaagaaagcc
tattacttgacccagaaaattcctgaccaggacttctatgcgtccgtgctggacgtcttg
acaccagatgatgttcgggttttggtggagatggaagatgagttttctcgtcgtggtcaa
tttgaaagaatttttccttcccgaatctcttctcgatatcttcggttttttgagcagcca
cgatatttcaacattctcaccacccagtgggaacagaagtaccatggaaacaagctcaaa
ggagtagatctgcttcggaattggtgctacaaaggcttccacacggggattgtctctgac
tcagccccactgtggtctctgccaacatcgctcatgactacctcaaagggtgatgggaca
ccaaattccgccagcaagtcacgaaagaagagcgcctctgagggaaccacactgtcctct
gaagacaggtcaacacccaagtctaagaagagtcaagctggcctgtctcccatatccagg
aagactttgtcctcaaggagcaatgagaacaccagcaaacagtccaagcgctctaccccg
gggttacctgtcctcaagtactctgggcagagttccagactttctgctgcttctgcttcc
cagtcagtcactgactcccgcttgactgctgtgagctcgtga

DBGET integrated database retrieval system