KEGG   Mus musculus (house mouse): 67538
Entry
67538             CDS       T01002                                 
Symbol
Zswim3, 4921517A06Rik, C86566
Name
(RefSeq) zinc finger SWIM-type containing 3
  KO
K17604  zinc finger SWIM domain-containing protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    67538 (Zswim3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     67538 (Zswim3)
SSDB
Motif
Pfam: DUF5909 DUF5575 SWIM MULE DDE_Tnp_ISL3
Other DBs
NCBI-GeneID: 67538
NCBI-ProteinID: NP_848462
MGI: 1914788
Ensembl: ENSMUSG00000045822
UniProt: Q8CFL8
Position
2:164647034..164664047
AA seq 695 aa
MELGSCFKTYEDFKECFSAYKKETRCSFIVRDCISVRFHNLNNGTSFREDILYVQVKFVC
IRTQSNRKKTRKVDRCPAYLLLQYNETLDRLFISELNTQHIHADSNASGGIPASKPQAIC
LHKLPPVQLSIRKDLDTAEKPSVEPSFCLDKIHKPSNPEQEGISPSDMAKIAKVMKNFLT
VDEGSMASFSVGTSQDLDRLSFQSSKMSDLFARFPETLLLHRVENSQGHILYAFLVENKE
RESRVVHFAVLKAETAPSVAKMLNIFTEFNSDWPKVKMVFVDPSFPHRAILQEIFPSART
LLSIYHTTRLLEKKLHQSSVNASFKRLMKEALREAVFVSSDASLKNLCEMSQVLLDEELF
SFLQAHWFSCELLWYIHVRKGLHACNTYMDSLDIVTSKVSSLFREQRSLLDCILHFVDYI
DFFNTKGLKSLPTNAPKLRRTRLPSTPPRPKKPFRICGGGDTRLPVEEVEETKADSAQSQ
LPQPQDQSSKAGMLDILHQSGSELAYKLCHNEWEVVQNSTHLVDEAGSSVAVQLLENSHQ
VSKDGCSCSCSFQQCYHLPCRHILALLHTSQQPVGEAMVCCRWQKKYQHLLDPNGELQDR
GIIPNTDQPEKQGQNHMIRDLSRELANLLMQTEGPELEERCSTLRKIVDIWADPYQLPES
SQQPVDFRDVGCLPFLWGKLEEADSPPLAEAMVHD
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggagctaggcagctgctttaagacctacgaggacttcaaggagtgtttcagcgcctac
aaaaaggagaccaggtgctccttcattgtcagggactgcatctccgtccgcttccataac
ctcaacaacggcacctctttccgcgaggatatcctatatgtgcaggtgaaatttgtctgt
attcggacgcagtcaaacaggaagaaaactcggaaggtggacaggtgtccagcgtatctg
ctgctgcaatacaacgagactctagatagactgtttatcagtgagttgaatacccagcac
attcatgctgactctaatgcttctggaggaatccctgctagcaagcctcaggcaatatgt
ctacacaaactcccgccggtgcagctcagcatcaggaaagaccttgatacagcagagaag
ccctcagtagagccgtcattttgcctcgataagatacacaagccctcaaatccagaacag
gagggcatcagtccttctgatatggccaagatagcaaaagtgatgaagaactttcttacc
gtggacgagggctcaatggcctccttcagtgtgggcaccagccaagacctagaccgactc
agcttccagagcagcaagatgagtgacctgttcgcccgattcccagagacactcttgctg
caccgggtggaaaacagccagggccatattctgtatgctttcttggtggagaacaaggag
cgagagagtcgagtggtgcacttcgctgtgctcaaggctgagacagcgccttctgtggcc
aagatgctcaatatctttacagaattcaactctgattggcccaaggtcaagatggtcttt
gtggacccttcattccctcaccgagcgatcttacaggagatcttcccctctgcccgcact
ctcctctctatctaccacaccactcgtctcttggagaagaagttacaccagagttcagta
aatgcgtcttttaaaaggctcatgaaagaagctctgcgggaagctgtgtttgtctcttct
gatgcaagcctaaaaaatctctgtgagatgtcccaagtcctactagatgaggaactcttc
agtttcctccaggcccattggttctcctgtgaactgctgtggtacatacatgtgaggaag
ggcctgcatgcatgtaacacctacatggacagcctagacatagtcaccagcaaggtgtca
agcctctttcgggaacagcggtctctgctggactgcatccttcactttgtggattacata
gacttctttaataccaaaggtctgaagagcttgcccacaaatgctcccaagttaaggaga
actcggctcccaagcacgcctccaaggcccaagaagccttttagaatttgtggtgggggt
gacaccaggctccctgtggaagaggtagaagagacaaaggcagactcagcacagtctcag
ttgccacagccccaggatcagtcctccaaggctggcatgctagacatcttgcaccagagt
ggctctgaactagcctacaagttgtgtcataatgagtgggaggtggtacagaattccacc
cacctggtagacgaggccggctcctcagtggctgttcagctgctagagaactcacaccag
gtgagcaaagatggctgtagctgcagctgctcctttcaacagtgctaccatctgccatgc
cgccacattttggctctgttgcataccagccagcagccagtaggggaagccatggtgtgc
tgccggtggcagaagaaataccagcacctccttgaccccaatggggagctgcaagaccgt
ggaatcatcccaaacacagatcagcctgaaaagcaaggtcagaaccacatgattcgggac
ctaagcagggagctggcaaacctgctgatgcagaccgaggggccagagctggaggagcgc
tgctccaccctgcgcaagattgtggacatctgggcagacccctatcagctgcctgagtcc
agtcagcagccagttgacttcagagacgtgggctgcctccctttcctctggggaaagcta
gaggaagcagacagcccccctcttgctgaagccatggttcatgattga

DBGET integrated database retrieval system