KEGG   Mus musculus (house mouse): 67547
Entry
67547             CDS       T01002                                 
Symbol
Slc39a8, 4933419D20Rik, BIGM103, ZIP-8, Zip8
Name
(RefSeq) solute carrier family 39 (metal ion transporter), member 8
  KO
K14714  solute carrier family 39 (zinc transporter), member 8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04216  Ferroptosis
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    67547 (Slc39a8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67547 (Slc39a8)
   05012 Parkinson disease
    67547 (Slc39a8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67547 (Slc39a8)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   67547 (Slc39a8)
SSDB
Motif
Pfam: Zip EF-hand_Zip DUF4271
Other DBs
NCBI-GeneID: 67547
NCBI-ProteinID: NP_001128621
MGI: 1914797
Ensembl: ENSMUSG00000053897
Position
3:135522644..135594333
AA seq 462 aa
MAPGRAVAGLLLLAATSLGHPSEGPELAFSEDVLSVFGANRSLSAAQLGRLLERLGAASQ
QGALDLGQLHFNQCLSAEDIFSLHGFSNVTQITSSNFSAICPAILQQLNFHPCEDLRKHN
AKPSLSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTYFVGLAIGTLFSNAIFQ
LIPEAFGFNPKIDNYVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKE
KTHQPKTLPLPAVNGVTCYANPAVTEPNGHIHFDTVSVVSLQDGKTEPSSCTCLKGPKLS
EIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNA
GMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDM
LREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGDIELQ
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctccgggccgggcagtggccgggctgctgctgctggcggccaccagcctgggacac
ccctcggagggaccggagctcgccttcagtgaggatgtgctgagcgtgttcggcgccaac
cggagcctgtcggccgcgcagctggggcgcctgctggagcgtctgggggctgcatcccag
cagggagcgctggacctgggccagctgcacttcaaccagtgtttgtcagcagaagacatc
ttttctcttcatggtttctcaaatgtcacccagataaccagctcgaacttctctgccatc
tgccccgcgatcttacagcagctgaacttccatccctgcgaggatctaagaaagcacaac
gcaaagcccagtctttccgaagtctggggctatggattcctgtcagtgacaattatcaat
ctggcctctctcctgggattgattttaacccccttgataaagaagtcttatttccccaag
attttaacttatttcgtgggactcgctattgggactcttttctcaaacgccattttccag
cttattccagaggcatttggatttaatcccaaaattgacaattacgttgagaaagcagtt
gctgtgtttggtggattttacatgcttttctttgtcgagagaacacttaagatgctactg
aaaacatatggccagaatgaccatactcacttcaggaatgatgactttggttctaaagaa
aaaacccaccaacccaaaacgttaccattgcctgcagtcaacggtgtgacttgctatgcc
aaccccgctgtcactgagcctaacggacacatccacttcgacactgtcagcgttgtatcc
ctccaggatggaaaaacagagccaagctcatgtacctgtctgaaggggcccaaactgtca
gaaataggaacaattgcctggatgatcacgctttgtgatgccctccacaatttcatcgac
ggcttggcgattggggcatcttgtactttgtctcttcttcaggggctcagtacgtccata
gcgatcctgtgtgaggagtttcctcatgagttaggggactttgtgatcttgctcaatgca
ggaatgagcacccggcaagccttgctgttcaacttcctctccgcgtgttcctgctacgtg
ggactagctttcggcattttggtgggcaacaattttgctcccaatattatatttgcactc
gctggaggcatgttcctctacatttctctggcagatatgtttccagagatgaacgacatg
ctgagagaaaaagtaactggaagacaaacggatttcaccttcttcatgatccagaatgca
gggatgttaaccggcttcactgccatcctgctcatcaccttgtacgcaggagacatcgaa
ttgcagtag

DBGET integrated database retrieval system