KEGG   Mus musculus (house mouse): 67554
Entry
67554             CDS       T01002                                 
Symbol
Slc25a30, 4933433D23Rik, AV025504, AV221431, AW319655, KMCP1
Name
(RefSeq) solute carrier family 25, member 30
  KO
K15106  solute carrier family 25 (mitochondrial carrier), member 14/30
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67554 (Slc25a30)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   67554 (Slc25a30)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 67554
NCBI-ProteinID: NP_080508
MGI: 1914804
Ensembl: ENSMUSG00000022003
UniProt: Q9CR58
Position
14:complement(75994986..76024477)
AA seq 291 aa
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIG
REEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVIS
SAIANPTDVLKIRMQAQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVEL
PVYDITKKHLILSGLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCA
GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcagccctcaactggaagccctttgtgtatggagggctggcctccatcacagcagaa
tgcggcacatttccaattgatttaactaagacacggcttcagattcaaggccagacaaat
gatgccaacttccgagagatcaggtaccgaggcatgctgcacgcgctgatgaggataggc
cgagaagaaggcctgaaggcgctgtattcagggattgcacccgcaatgctgcgccaggcc
tcctatggaaccatcaagatcggcacgtaccagagcctgaagcggttagctgtggaacgc
ccagaagatgaaaccctgctggtcaatgttgtgtgtggaattctgtctggagtcatatcc
tcagctattgctaatccgactgatgttttgaaaatccgaatgcaagcacagaacagcgct
gttcaaggaggcatgatagacagcttcatgagcatttaccagcaggaggggactagagga
ctgtggaagggtgtgtccctcacagcccagagggcagccattgtggtcggcgtggagctt
ccagtctatgacatcaccaagaagcacctgatactctcaggcctgatgggagacactgtc
gcaacgcattttctctcgagcttcacctgtggcctggtgggggccttggcctcaaaccca
gttgatgttgtgagaacccgcatgatgaatcagagagcccttcgagatggcagatgtgcg
ggctataagggtaccttggattgcctattgcagacatggaagaatgaagggttttttgct
ctatataaaggattttggccaaattggttgcgccttggtccttggaatatcattttcttt
ttgacttacgaacaactgaagaaactggacttgtga

DBGET integrated database retrieval system