KEGG   Mus musculus (mouse): 67554
Entry
67554             CDS       T01002                                 

Gene name
Slc25a30, 4933433D23Rik, AV025504, AV221431, AW319655, KMCP, KMCP1
Definition
(RefSeq) solute carrier family 25, member 30
  KO
K15106  solute carrier family 25 (mitochondrial carrier), member 14/30
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67554 (Slc25a30)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   67554 (Slc25a30)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 67554
NCBI-ProteinID: NP_080508
MGI: 1914804
Ensembl: ENSMUSG00000022003
UniProt: Q9CR58
Position
14; 14 D3
AA seq 291 aa
MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIG
REEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVIS
SAIANPTDVLKIRMQAQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVEL
PVYDITKKHLILSGLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCA
GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcagccctcaactggaagccctttgtgtatggagggctggcctccatcacagcagaa
tgcggcacatttccaattgatttaactaagacacggcttcagattcaaggccagacaaat
gatgccaacttccgagagatcaggtaccgaggcatgctgcacgcgctgatgaggataggc
cgagaagaaggcctgaaggcgctgtattcagggattgcacccgcaatgctgcgccaggcc
tcctatggaaccatcaagatcggcacgtaccagagcctgaagcggttagctgtggaacgc
ccagaagatgaaaccctgctggtcaatgttgtgtgtggaattctgtctggagtcatatcc
tcagctattgctaatccgactgatgttttgaaaatccgaatgcaagcacagaacagcgct
gttcaaggaggcatgatagacagcttcatgagcatttaccagcaggaggggactagagga
ctgtggaagggtgtgtccctcacagcccagagggcagccattgtggtcggcgtggagctt
ccagtctatgacatcaccaagaagcacctgatactctcaggcctgatgggagacactgtc
gcaacgcattttctctcgagcttcacctgtggcctggtgggggccttggcctcaaaccca
gttgatgttgtgagaacccgcatgatgaatcagagagcccttcgagatggcagatgtgcg
ggctataagggtaccttggattgcctattgcagacatggaagaatgaagggttttttgct
ctatataaaggattttggccaaattggttgcgccttggtccttggaatatcattttcttt
ttgacttacgaacaactgaagaaactggacttgtga

DBGET integrated database retrieval system