KEGG   Mus musculus (mouse): 67555
Entry
67555             CDS       T01002                                 

Gene name
Mgat4d, 4933434I20Rik, GnT1IP, GnT1IP-L
Definition
(RefSeq) MGAT4 family, member C
  KO
K00738  alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase A/B [EC:2.4.1.145]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    67555 (Mgat4d)
   00513 Various types of N-glycan biosynthesis
    67555 (Mgat4d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    67555 (Mgat4d)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     67555 (Mgat4d)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  N-Glycan
   67555 (Mgat4d)
SSDB
Motif
Pfam: Glyco_transf_54
Other DBs
NCBI-GeneID: 67555
NCBI-ProteinID: NP_080509
MGI: 1914805
Ensembl: ENSMUSG00000035057
Vega: OTTMUSG00000024986
UniProt: Q9D4R2
Position
8; 8 C2
AA seq 373 aa
MKAKNVNLLFAFVAVLLFGFSCFCISRMNQTNNQLINCRNHVLEFKEIMLRLKNKSENHH
QDLMQVLYQMKRKAAHTTRSSGNFLEKKGSILSQHETLPNQFEVLKYFLPHLRTAGKLYP
AIATSKGRAGVSFALGISTINRGNHTYLKQTLTSVLSRMTPEEEEDSVVIVSVADTDESY
LKSVVRMVKTKFRKQVQSGVLEVISIPTLFYPQTLLDKKTKTDSESWQIKQVLDFCILML
YAQPKATYYLQLEDDIVAKKMYFTKMKDFVNSLTSKNWFFIEFSVLGFIGKLFRSKDLTD
FVHFFLMFYETKPIDILLDDIFLIRVCISGEPVRSCLQRKKGFRIQYRPSLFQHVGTQSS
FPGREQHLKDNYY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaggccaagaacgttaacttgctcttcgccttcgttgccgtcctgctctttggtttc
tcgtgtttctgcatctccaggatgaaccaaaccaataatcaactaattaactgcagaaac
cacgttttggagtttaaagaaattatgctccgtttaaaaaacaaaagtgaaaatcatcac
caagacctaatgcaagtcttgtatcaaatgaagcgtaaagctgcccacacaacaagatca
tcagggaacttccttgagaagaaggggagcatattgagtcagcatgaaacacttcctaac
caatttgaagtcttaaagtacttccttcctcatctaaggacagcagggaaactttaccca
gctatagccactagcaaagggagagcaggcgtttcctttgcactgggaatctccaccatt
aacagagggaaccacacctacctgaagcaaacgctgacctctgttctctccagaatgact
cccgaagaagaggaggactctgtggtgatcgtctctgtcgctgatactgatgaaagttat
ttaaaatctgttgttcgcatggttaaaaccaaattcagaaagcaagtgcagtccggcgtc
ttggaggtcatttcaatacccacccttttttatcctcaaacattactggacaagaaaacg
aagacggactcagaaagttggcaaataaaacaagtattggacttctgtattctgatgctg
tatgcccagcccaaggccacgtattatttacagctagaagatgatatcgtagcaaaaaag
atgtattttacaaaaatgaaagattttgtaaatagtctcacttcaaaaaattggtttttt
attgagttttcagtccttggatttatagggaaactctttcgatcgaaggacctcactgac
tttgtgcattttttcctgatgttctatgagacaaagcccatagatatacttttagatgac
attttcctgatccgggtgtgcatctcaggggagcctgttaggagctgtttgcagcgaaag
aagggatttcgaattcagtacagaccatctctgttccagcatgtgggcactcagtcatca
tttccaggacgagaacagcacctcaaggataattattactag

DBGET integrated database retrieval system