KEGG   Mus musculus (house mouse): 67563
Entry
67563             CDS       T01002                                 
Symbol
Ciao3, 9030612I22Rik, AI504405, Narfl, PRN
Name
(RefSeq) cytosolic iron-sulfur assembly component 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Fe_hyd_lg_C Fe_hyd_SSU FAD_syn
Other DBs
NCBI-GeneID: 67563
NCBI-ProteinID: NP_080514
MGI: 1914813
Ensembl: ENSMUSG00000002280
UniProt: Q7TMW6
Position
17:25992750..26002306
AA seq 476 aa
MASPFSGALQLTDLDDFIGPSQNCIKPVKVAKKPGSGIAKIHIEDDGSYFQVNQDGRTQK
LEKAKVSLNDCLACSGCVTSAETVLITQQSHEELRKVLDANKEAAPGQQRLVVVSISPQS
RASLAARFRLDPTDTARKLTSFFKKIGVHFVFDTAFARNFSLLESQKEFVQRFREQANSR
EALPVLASACPGWICYAEKTHGNFILPYISTARSPQQVMGSLVKDFFAQQQLLTPDKIYH
VTVMPCYDKKLEASRPDFFNQEYQTRDVDCVLTTGEVFRLLEEEGVSLTELEPAPLDGLT
SSVSAEEPSSHRGGGSGGYLEHVFRHAAQELFGIHVAEVTYQPLRNKDFQEVTLEREGQV
LLRFAVAYGFRNIQNLVQKLKRGRCPYHYVEVMACPSGCLNGGGQLKAPDTEGSELLQQL
ERLYSMVRTEAPEDAPGVQELYQHWLQGEDSERASRLLHTQYHAVEKPSSGLSIRW
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcgtcgcccttcagtggggcactacagctgaccgacttggacgacttcatcgggcca
tctcagaattgcatcaagcctgtaaaggtggctaagaagccaggaagtggcatagccaag
atccacattgaagacgatggcagttacttccaagtgaaccaagacggaagaacccagaag
ctggagaaggccaaggtctccctgaatgactgcctggcgtgcagcggctgtgtcacctca
gcagagacagtactcatcacccagcagagtcacgaggaactgcggaaggttctagatgct
aataaggaggcagcacctggtcagcagcggctggtggtcgtttccatatcgccgcagtcc
agagcatcactggctgccaggtttcggctggaccccacagacactgccaggaaattaact
tcattcttcaaaaaaataggggtccactttgtctttgatactgccttcgcgaggaacttc
agccttttggaaagccaaaaagagtttgtgcagcgcttccgagagcaagccaactccaga
gaggccttgcctgtgctggcttccgcctgcccaggctggatctgctatgctgagaagaca
catggcaacttcatcctcccctacatcagtacagcccggtccccacagcaggttatgggc
tccctggtcaaagacttcttcgcacaacagcagcttctgactcctgacaagatctaccat
gtaacagtgatgccctgctatgataaaaagctagaagcatccagacctgacttcttcaac
caggagtaccagacccgtgatgtggactgtgtccttacaacaggagaagtcttcaggctg
ctggaggaagaaggagtctccctcacggagctggagcctgcgcccctggatggcttaacc
agtagtgtgtctgctgaggagcccagcagccatcggggcggaggctcaggaggctacctg
gagcatgtgttccggcacgcagcccaagagctctttggaatccacgtggctgaagtcacc
tatcaacccttgaggaacaaggacttccaggaagtgacactggaaagggaaggccaggta
ctgttgcgctttgctgtggcctatggtttccgtaatatccagaacctcgtgcagaagttg
aaacgaggccgctgtccctaccattacgtggaagtaatggcctgcccttcaggttgcttg
aatggagggggccagctcaaggctccggatacagagggcagcgagctccttcagcagctg
gaaagactgtacagcatggtgaggactgaggcgcccgaagatgcaccgggggtccaggag
ctgtaccagcactggctgcaaggagaggactcagagcgggccagccgcctgctgcacaca
caataccatgccgtggagaagcccagctcaggcctgagcatcaggtggtag

DBGET integrated database retrieval system