KEGG   Mus musculus (mouse): 67578Help
Entry
67578             CDS       T01002                                 

Gene name
Patl2, 4930424G05Rik, Pat1a
Definition
(RefSeq) protein associated with topoisomerase II homolog 2 (yeast)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PAT1
Motif
Other DBs
NCBI-GeneID: 67578
NCBI-ProteinID: NP_080527
MGI: 1914828
Ensembl: ENSMUSG00000027233
Vega: OTTMUSG00000015532
UniProt: A2ARM1
Position
2 E5; 2
AA seq 529 aa AA seqDB search
MKCLEGLHLQQRPSKFSVSLAPEEGLVCAFQLEEEKENEDECVCSDQAPEVKEEGCGLGD
PAIVSAFQNTQVPQQRGLHSSHRVKVSGALGMSSASLHFMWQSVFPRASSPAHHFGPQQP
SPDPFLFYSPLTPWPPKLSLPSHLTQLHPQHQQILQQQQRWRRRRSPTARSVPAQKPWSR
EPAASDAYANLMTRKEKDWVIRVQMVQLQSENPRLDDYYYQKYYQKLEKRQADKELLGQK
TRAESLKLVTPYIQKPEVYESVVRIEGSLGQVAVSTCFSPRRAIDAVSHGTQEQDTGAAS
SQRLRVLSQIEKMFLQLLKIEEGQNDGLPQLYHTREQSSQVEKLFQALKTQEQNNLEEAA
DNLLQVLSVRKGKVLVARLLPFLPPDQAVSLLLYITYHLPLLIQRDMADQGLHMLFKPLG
KYISHLTFHQLLHAMQGLMLLSPGSSERPVSVVLQNQFGISLLYALLSHGEQLVSLDPSL
RSSSDCATWTDLVILIAWEIAQLPAASLAEPLAFPRNLLPCSAITWTSN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgccttgaaggtctgcacttacagcagagacccagcaagttctctgtctccttg
gctcctgaagaaggcttagtgtgtgccttccaactggaggaagagaaggagaatgaagat
gaatgtgtgtgttcagatcaggctccagaagtgaaggaggaagggtgtggtctcggggat
ccagccatagtgagcgccttccaaaatacccaagtaccacagcagagagggctgcacagt
tcccacagagtcaaggtctctggtgccttggggatgtcatcagcctccctgcattttatg
tggcagtctgtgtttccaagagccagttctccagcccatcattttggaccgcaacagcct
tcaccagatccttttctgttctacagcccactgaccccgtggccccctaagctcagcctt
cccagtcatctgacccagctccaccctcagcaccagcagatcctgcagcagcagcaacgg
tggcgtaggaggcggagtccaacagcaagaagtgtccccgcccagaagccttggtctcgt
gagccagctgcctcagatgcctatgctaacctcatgacccgaaaagagaaggactgggtg
ataagagtgcagatggttcaactgcagagtgagaacccccgcctggatgattactactac
cagaaatactatcagaagctggagaagagacaggcagacaaagagctgcttggacaaaag
accagggctgagtctctcaagttggtcacgccttacatccagaagcctgaagtttatgag
tcagtggtgcggattgagggttccctgggccaggtagctgtatcaacatgttttagccct
cgccgagctattgacgctgtatctcacggaacccaagagcaggatacaggagctgcgagc
agccagaggcttcgggtattgtcccagattgagaagatgttccttcagttactaaaaata
gaggagggccagaatgatgggctcccacaactctaccacactcgggaacagagcagccag
gttgagaagctctttcaggccttaaaaacccaggagcagaacaacctggaggaggcagca
gataacctcctgcaagtgctgtctgtgaggaaagggaaagttttggtggctcggctgctc
cccttcctgcccccggatcaagctgttagcctcctcctgtacatcacctaccatctgccc
ctcctgatccagagggacatggctgaccagggtctacacatgctattcaaacctctgggg
aaatatatcagtcatctgaccttccatcagctcctccatgcaatgcaaggactaatgttg
ctatcacctggctcctcagagcggccagtctctgtggtacttcagaatcagtttgggata
tctctgctatatgccttgctgagtcatggagagcagctggtatccctggatccttccctc
cgatccagcagtgactgtgcaacctggacagacttggtgattctgattgcctgggagata
gctcagttgcctgcagcatccttggcggagcctctagccttccccaggaatctgcttccc
tgttctgccatcacatggacaagcaattag

DBGET integrated database retrieval system