KEGG   Mus musculus (mouse): 67586Help
Entry
67586             CDS       T01002                                 

Gene name
Ubxn11, 4930506L07Rik, D4Bwg1540e, Soc, Soci, Ubxd5
Definition
(RefSeq) UBX domain protein 11
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SEP UBX FAM76 DUF1635 IncA MnmE_helical Exonuc_VII_L TMPIT OmpH
Motif
Other DBs
NCBI-GeneID: 67586
NCBI-ProteinID: NP_080533
MGI: 1914836
Ensembl: ENSMUSG00000012126
Vega: OTTMUSG00000010232
UniProt: Q9D572
Position
4 D3; 4 66.5 cM
AA seq 484 aa AA seqDB search
MSSPLASLSKTRKVPLESESVNPGRRGIRVYGNEDEVDMWNDGQDSEEKISLPSCYGGIG
APVSRQGPHDSELMASMTRKLQELEQQLQAQNDEMLSKERKILDLEDLVQTLQQHQNNAA
LQRQEELETQCIQLQRQIGEMERFLSDYGLQWVGEPMDQENSEEKTVSENDERDWMKAKK
FWKPGDSFVPPEVDFDKLMASLQDLSELVEGEAQVTPVPGGARFRTLEPIPLKVYRNGIM
MFDGPFRPFYDPSTQRCLRDILDGFFPSELQRLYPDGVPFKVSDLRNQIYPEDGLGQFPG
EGRVVGRQKMRKVTDRVEETSGSRMTAEQFLNRLPKCIIRQGEVIDIRGPIRDTLQNCCP
MPARIQEIIVETPALASERQRSQESPDMPMPLLSMLRIKSENGEQAFLLMMWPEDTIGDV
RKLLAQARDMDSAAFEILSTFPPTVYQDDTVTLQAAGLVPNATLLLRTRRALLSNPISRP
GSLP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagctcacctctggcctctcttagcaagacgcggaaggtgcccctagagtcggagtct
gtgaatcctgggagacgagggataagagtctacggaaatgaagatgaggtggacatgtgg
aatgatggccaagactcagaagagaagatctctctgccttcctgctatggaggcatcggt
gcccctgtgagtaggcaaggaccccatgactcagagctgatggcctccatgaccaggaag
ctgcaggagctggagcagcagttgcaggcccagaacgacgagatgctgtccaaggagcgg
aagatcctggacctggaggatttggtacagaccctccagcagcaccagaacaatgcagcc
ctgcagaggcaggaggagctggagacacaatgcattcagctgcagcggcagattggtgag
atggagcggtttctcagcgactatggcctgcagtgggtgggcgagcccatggaccaggag
aactcagaggaaaagacagtctctgaaaatgatgagcgagactggatgaaggccaagaag
ttttggaagccaggggattcttttgtgccccccgaggtggactttgacaaactgatggcc
agtctacaggatctgagtgagctggtggagggagaggcccaggtgactccggtgcctggt
ggggctcggttccgtaccctagagcccatcccgctgaaggtctaccggaatggcattatg
atgtttgatgggcccttccggcccttctacgatccctccacgcagcgctgcctccgggac
atactggatggcttctttccctcagagctgcagaggctgtatcctgatggagtccccttt
aaggtaagtgacctgcgaaatcagatctacccagaggatggtctgggccaattcccaggt
gagggtcgtgtggtgggccggcagaaaatgcgcaaggtcacagacagggtggaggagact
tcaggctccaggatgactgctgaacaattcctgaacaggcttcccaagtgtataatccga
caaggcgaggtgattgacatccggggccccatcagggacaccttgcagaactgctgccca
atgcctgcccggatccaggagatcatagtggagacacctgccttggcttctgagcggcag
aggagccaggagtcacctgacatgccaatgcctctgctctccatgcttcgcatcaagtcc
gagaacggagagcaggccttcctgctgatgatgtggcctgaggataccattggcgacgtg
cggaaactcttagcacaggccagggacatggattcagctgcctttgagatcttgagcacc
ttcccgcccacggtctaccaggacgatacagtgactctgcaggccgcaggcctggttccc
aatgcaacgctgctgttgcggacccgcagagccctgctgtcgaaccccatctcccgccca
ggctcactgccctga

DBGET integrated database retrieval system