KEGG   Mus musculus (mouse): 67604
Entry
67604             CDS       T01002                                 

Gene name
Get4, 1110007L15Rik, AW412535, Cee
Definition
(RefSeq) golgi to ER traffic protein 4
  KO
K23387  golgi to ER traffic protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67604 (Get4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67604 (Get4)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Golgi to ER traffic proteins (GET)
    67604 (Get4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   BAG6-UBL4A-GET4 complex
    67604 (Get4)
SSDB
Motif
Pfam: DUF410 Vps39_1
Other DBs
NCBI-GeneID: 67604
NCBI-ProteinID: NP_080545
MGI: 1914854
Ensembl: ENSMUSG00000025858
Vega: OTTMUSG00000025183
UniProt: Q9D1H7
Position
5; 5 G2
AA seq 327 aa
MAAAAAMAEQEGARNGARNRGGVQRVEGKLRASVEKGDYYEAHQMYRTLFFRYMSQSKHA
EARELMYSGALLFFSHGQQNSAADLSMLVLESLEKAEVDVADELLENLAKVFSLMDPNSP
ERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHFLHSSDGEGCANMLV
EYSTARGFRSEVDMFVAQAVLQFLCLKNKNSALVVFTTYTQKHPSIEDGPPFVQPLLNFI
WFLLLAVDGGKLAVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGN
LLSSLMGSSEQEEGEESQDDSSPIELD
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcgatggcagagcaggagggcgcccgcaacggcgcccgcaaccgc
ggcggcgtccagcgcgtggagggcaagctgcgtgctagcgtcgagaagggcgactactac
gaggcgcaccagatgtaccggaccctcttcttcagatacatgtctcagagcaaacatgca
gaggcccgggagcttatgtactcaggagcattgctcttcttcagtcatggccagcagaac
agtgcagctgacctgtccatgctggtcctcgaatccctggaaaaggccgaggtggacgta
gctgatgagcttttggaaaatctggctaaagtgttcagtttgatggatccaaattctcct
gaacgagtagcttttgtgtccagagccctgaagtggtccagtggagggtctgggaaactg
ggccatcctcgactccaccagctgctggccctcacattatggaaagagcaaaattactgt
gagtctcggtatcactttctgcactccagtgatggcgagggctgcgccaacatgctggtc
gagtactctactgcccgaggcttccgaagtgaggtggacatgttcgtggctcaggctgtg
ctacagtttctctgtttgaaaaataagaacagtgcactggtggtctttacaacgtacaca
cagaagcatccatccatcgaggatgggccgccctttgttcagcccctgctcaatttcatc
tggtttctgctgctggccgtggacggtggcaagctggctgtcttcacggtgctgtgcgag
cagtaccagccgtccctgcggagggaccccatgtacaacgagtacctcgacaggatcgga
caactcttcttcggtgtgccgccaaagcagacatcctcctatggaggcttgctagggaac
ctgctgagcagcctcatgggctcctcagagcaggaagagggggaagagagccaggatgac
agcagccccatcgagctggactga

DBGET integrated database retrieval system