KEGG   Mus musculus (house mouse): 67606
Entry
67606             CDS       T01002                                 
Symbol
Fibin, 1110018M03Rik
Name
(RefSeq) fin bud initiation factor homolog (zebrafish)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Fibin
Other DBs
NCBI-GeneID: 67606
NCBI-ProteinID: NP_080547
MGI: 1914856
Ensembl: ENSMUSG00000074971
UniProt: Q9CQS3
Position
2:complement(110191270..110193338)
AA seq 217 aa
MVFPKLIWMGFFCHLCRGYFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSD
RRRCSQGEGGQASSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLR
RESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDIS
VGLRDKYELLAHTIRSHGTRLGRLKSDYLEGGAQKTG
NT seq 654 nt   +upstreamnt  +downstreamnt
atggtgttcccgaagttgatctggatgggtttcttttgccacctgtgtcgaggctacttt
gatggccccctgtacccagaaatgtctaatgggactttgcatcattacttcgtgcctgat
ggagactatgaggagaatgatgaccccgagaaatgccagctgctcttcagggtgagtgat
cgcaggcgctgctcccagggggaagggggccaagccagtagcttgctgagcctcactctt
cgagaggagttcacagtactgggccgccaggtggaggatgctggacgcgtcctggagggc
atcagcaagagcatctcctacgacctggatggggaagagagctatggcaagtacctgagg
cgggagtcccaccagatcggggatgcctactccaactctgacaagtccctcactgagctg
gaaagcaagttcaagcagggccaagagcaggatagccggcaggaaagcagactcaatgag
gacttcctggggatgctggtccacaccaggtccttgctgaaggagacactggacatctct
gtggggctcagagacaaatacgagctgctggcacataccatcaggagccatgggacccgc
ttaggtcgactgaaaagcgactatctggagggtggggcacagaagacaggctaa

DBGET integrated database retrieval system