KEGG   Mus musculus (mouse): 67618Help
Entry
67618             CDS       T01002                                 

Gene name
Aasdhppt, 2010309J24Rik, 2810407B07Rik, AASD-PPT, CGI-80, LYS2, LYS5
Definition
(RefSeq) aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
  KO
K06133  4'-phosphopantetheinyl transferase [EC:2.7.8.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    67618 (Aasdhppt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     67618 (Aasdhppt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-GeneID: 67618
NCBI-ProteinID: NP_080552
MGI: 1914868
Ensembl: ENSMUSG00000025894
Vega: OTTMUSG00000061683
UniProt: Q9CQF6
Position
9; 9 A1
AA seq 309 aa AA seqDB search
MVFPAKRLCVVPSMEGVRWAFSCGTWLPSRAEWLLAMRSIQPEEKERIGKFVFARDAKAA
LAGRLMIRKLVAEKLNIPWDHIRLQRTSKGKPVLAKDSLNPYPNFNFNISHQGDYAVLAA
EPEVQVGIDIMKTSFPGRGSIPEFFHIMKRKFTKKEWETIRSFNDEWTQLDMFYRHWALK
ESFIKAIGVGLGFEMQRLEFDVSPLNMDIGQVYKETCLILDGEEEKEWAFEESKIDEHHF
VAVAVRKPDGSRHQNVSYQDDSKLSQRKFTILNFNDLVASAIPMTPEDPSFWDCFCFTEE
ILIRNGTKS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgttccccgctaagaggctgtgcgtggtgccatccatggagggcgttcgttgggca
ttctcctgcggtacctggctgccaagtcgagccgaatggcttctggcgatgcggtctatc
cagccggaggagaaggagcgcatcggcaagttcgtgtttgcccgcgacgccaaggcagcc
ttggctggtcgtttgatgataaggaaattagttgcagagaaattgaatatcccttgggat
catatccgtctgcagagaacttcaaagggaaagccggttcttgcgaaagactcgttgaat
ccatatcccaatttcaactttaacatctctcaccaaggggactatgcagttcttgctgca
gaacctgaggtacaggttggcattgatatcatgaagactagttttccaggtcgtggttca
attccagaattctttcatatcatgaaaagaaagtttaccaaaaaggagtgggaaacaatc
agaagttttaatgatgaatggactcagctggatatgttttaccggcactgggcactgaaa
gaaagcttcataaaagccattggagttggattgggatttgaaatgcagcggcttgaattt
gatgtatctccattaaacatggacattggtcaggtttataaggaaacctgtttgattttg
gatggggaagaagaaaaagaatgggcctttgaggaaagcaaaatagatgaacaccatttt
gttgcagtggctgttaggaagcctgatggatctagacatcaaaatgtttcatatcaagat
gattctaagctatcccagaggaagtttaccattcttaattttaatgatttggtagcatct
gctattcctatgacacctgaggatccttcattttgggactgtttttgcttcacagaagaa
attctaatacgaaatggtaccaagtcatga

DBGET integrated database retrieval system