KEGG   Mus musculus (mouse): 67619
Entry
67619             CDS       T01002                                 

Gene name
Nob1, 1700021I09Rik, ART, ART-4, No, Nob1p, Psmd8, Psmd8bp1
Definition
(RefSeq) NIN1/RPN12 binding protein 1 homolog
  KO
K11883  RNA-binding protein NOB1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    67619 (Nob1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    67619 (Nob1)
   03051 Proteasome [BR:mmu03051]
    67619 (Nob1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    67619 (Nob1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    67619 (Nob1)
SSDB
Motif
Pfam: PIN_6 NOB1_Zn_bind WRNPLPNID
Other DBs
NCBI-GeneID: 67619
NCBI-ProteinID: NP_080553
MGI: 1914869
Ensembl: ENSMUSG00000003848
Vega: OTTMUSG00000035977
UniProt: Q8BW10 Q148S3
Structure
PDB: 
2CON

Position
8; 8 D3
AA seq 403 aa
MAPVEHVVADAGAFLRDAPLQDIGKNIYTIREVVREIRDKATRRRLAVLPYQLRFKEPLP
EYVRLVTEFSKKTGDYPSLSATDIQVLALTYQLEAEFVGVSHLKKEPEKAKVSSSIQHPE
TALHISGFHLPSKSKPLQEAVDRGHAADGPENLEFSSFMFWRTPLPNIDRELQELLIDGR
EEEEEEEECEDSDDDGGGWITPSNIKQIQQELEQCDTPEDVQVGCVTTDFAMQNVLLQMG
LHVLAVNGMLVREARSYILRCHGCFKTTSDMNRVFCGHCGNKTLKKVSVTINDDGTLHMH
FSRNPKVLNPRGLRYSLPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTDVFAPDYIAG
VSPFAENDISSRSAILQVRDGMLGAGRRRLNPNASRKKFVKKR
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcgccggtggagcacgttgtggctgatgccggagctttcttgagggacgcgcctctg
caggacatcgggaagaacatctacaccatccgggaggtggtgcgagagattcgcgacaag
gccacgcgcaggcggctggcagtgctgccctaccagcttcggttcaaggagcctctccca
gagtacgtgcggctggtaactgagttttccaagaaaactggggactaccccagcctctct
gccacagatatccaggtgctggctctgacttaccagctggaagcagaatttgtcggggtg
tctcatctaaaaaaagaaccagagaaggctaaagtgagctcttcaattcagcaccctgaa
actgctctgcacatttctggcttccatctgccctccaagtctaaacccttacaagaagca
gtggatcggggccacgcagctgatgggcccgagaacctggagttcagctccttcatgttc
tggaggaccccgctgcctaacattgaccgtgagctgcaggagctgctgattgatggaagg
gaggaggaagaggaggaggaggagtgtgaagacagtgatgacgatggtggtgggtggata
acccccagcaacataaagcagatccagcaggagttggagcagtgtgacaccccagaggac
gtgcaggttggctgtgtgaccacggacttcgccatgcagaatgttctacttcagatgggg
ctgcacgtgttggcggtgaacggcatgctggtccgagaggcccggagctacatcctgcgc
tgtcatggctgtttcaagacgacatcggacatgaaccgagtgttctgtggacattgtggg
aacaagaccctgaagaaagtgtctgtgactatcaatgacgatgggaccttgcacatgcat
ttctcccgaaacccgaaagttctgaacccacgaggcctccggtactcactacccactcca
aaagggggcaaatacgccatcaacccccatctgaccgaggatcagcgcttcccccagctg
cgactctcccagaaggccaggcagaagaccgacgtgttcgcccctgactacatagccggg
gtttctccctttgcagagaatgacatctccagccgctcggccatcctgcaagtccgggac
ggcatgttgggagccgggaggagacgcttaaatcccaatgcctccagaaagaagtttgta
aagaaaaggtga

DBGET integrated database retrieval system