KEGG   Mus musculus (mouse): 67621
Entry
67621             CDS       T01002                                 

Symbol
Bend5, 2310026E23Rik
Name
(RefSeq) BEN domain containing 5
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BEN T4SS OmpH Sec8_exocyst DUF5917 LMBR1 PIN_12
Other DBs
NCBI-GeneID: 67621
NCBI-ProteinID: NP_080555
MGI: 1914871
Ensembl: ENSMUSG00000028545
Vega: OTTMUSG00000008488
UniProt: Q8C6D4
Position
4:111271993..111317495
AA seq 421 aa
MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGAEPESPPRAPRD
WGALLLHKAQILALAEDKSDLENSVMQKKIKIPKLSLSHVEDDGEVKDYGEEDLQLRHIK
RPEGRKPSEAAHKSIEAVVARLERQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPR
ALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQD
VLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVH
LGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAIPKPPL
SPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtacgcctttgtgcggttcctggaggacaacgtctgctacgcgctgcccgtgtcgtgc
gtgcgcgacttcagtccccgctcgcgactggattttgacaaccagaaggtgtacgcggtg
taccggggcccggaggagctgggcgccgagcccgagagtcccccgcgtgcccctcgggac
tggggcgcgctgttgctccacaaggcccagatcctggcgctggcagaagacaaatctgac
cttgagaacagtgtgatgcagaagaaaataaaaatccccaaactttctctcagtcatgta
gaagatgatggggaggttaaagactatggggaagaagatttacagcttagacacatcaag
agaccggaggggcggaagcctagtgaagcggctcacaagagtatcgaggcagtggtggcc
cggctagagagacagaacggcctgagcctgggccacagcacttgtccagaagaggtcttt
gtggaggcctcaccgggcacagaggacatggacagtctggaggatgctgtcgtgccccgg
gctctgtatgaggagctgctgcgaaactaccagcagcaacaagaggagatgcgccacctc
cagcaggagctggagcggactcggaggcagctcgtacagcaggccaagaagctcaaggag
tacggggcattggtgtctgaaatgaaggagctccgagacctcaacaggagactccaagat
gtgctactcctgcggcttggcagcggtcccgccattgacttggaaaaagtaaagtcagaa
tgtctcgagcccgagccggagttacggagcactttcagtgaggaagcaaatacgtcgtcc
tattaccccgctcctgcgcctgtcatggacaagtatatcctagacaatggcaaggtccat
ctgggaagcgggatttgggttgatgaggagaaatggcaccagctacaagttacccaagga
gattctaagtacacgaagaacttggcagtcatgatctggggaacagatgttctgaaaaac
agaagtgtcacaggagtcgccacaaaaaaaaagaaggatgcaatcccaaagccacccctc
tctcctcacaagctcagcatcgtcagagagtgtttatatgacagaatagcacaagaaacg
gtggatgaaacggaaattgcacagagactctccaaagtcaacaagtacatctgtgagaaa
atcatggatatcaacaaatcttgtaaaaatgaagaacgaagggaagcaaaatacaatttg
caataa

DBGET integrated database retrieval system