KEGG   Mus musculus (mouse): 67622
Entry
67622             CDS       T01002                                 

Symbol
Mxra7, 1810057P16Rik, E130302J09Rik
Name
(RefSeq) matrix-remodelling associated 7
  KO
K24401  matrix remodeling-associated protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    67622 (Mxra7)
SSDB
Motif
Pfam: RSN1_TM
Other DBs
NCBI-GeneID: 67622
NCBI-ProteinID: NP_080556
MGI: 1914872
Ensembl: ENSMUSG00000020814
Vega: OTTMUSG00000003781
UniProt: Q9CZH7
Position
11; 11 E2
AA seq 178 aa
MESPVELLAALPALVTALALLLAWLLLRRGAARVPAPESTASDEAPGAPAPPEPPESCAP
EPAPEGPSQSERVAEPEESEAEEPAAEGRQDEDSDSEMGPPTEEPEEEDGAAFSFKYSPG
QLRGSQYKKMMTKEELEEEHRVQKEQLAAIFKLMKDNKDTFGEMSDGDMQEQLRLYDM
NT seq 537 nt   +upstreamnt  +downstreamnt
atggagtcgccggtcgagctgctggccgcgctacccgcgctggtcacggcgctggcgctg
ctgctcgcctggctgctgctgcggcgtggggcggcccgggtcccggccccggagagcacc
gcctcggacgaggcccccggggctcctgcgccgcctgaacctccagagtcttgcgccccg
gagcctgcaccggagggaccgagccagtccgagcgcgtggcggagccggaggagtccgag
gcggaggagccagcggccgaggggaggcaggatgaagactcagacagtgagatggggcca
cccactgaagaacctgaggaagaagacggagcagccttctcctttaaatacagccctggg
cagctgaggggaagccagtacaagaagatgatgaccaaagaagaactggaggaggaacac
agagttcagaaagaacagctggctgccatcttcaagctcatgaaggacaacaaggacacc
tttggcgagatgtcagacggggacatgcaggagcaactccgactctatgacatgtag

DBGET integrated database retrieval system