KEGG   Mus musculus (mouse): 67629Help
Entry
67629             CDS       T01002                                 

Gene name
Spc24, 2410030K01Rik, AV109292, Spbc24
Definition
(RefSeq) SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae)
  KO
K11549  kinetochore protein Spc24, animal type
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67629 (Spc24)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      67629 (Spc24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spc24 Fez1 UPF0242 DUF4404 PilO IL31 MetOD2 AAA_23 FUSC GAS
Motif
Other DBs
NCBI-GeneID: 67629
NCBI-ProteinID: NP_080558
MGI: 1914879
Ensembl: ENSMUSG00000074476
Vega: OTTMUSG00000063570
UniProt: Q9D083
Position
9; 9 A3
AA seq 201 aa AA seqDB search
MAAFRDMVEVSNWLLSLLGANRAEAQQRRLLGSYEQMMERLLEMQDGAYRQLRETLAVEE
EVAQSLLELKECTRQGDTELQQLEVELQRTSKEDTCVQARLRQLITELQELREMEEELQR
QERDVDEDNTVTIPSAVYVAHLYHQISKIQWDYECEPGMIKGIHHGPTVAQPIHLDSAQL
SPKFISDYLWSLVDTTWEPEP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcggctttccgcgacatggtggaggtgagcaactggctactgagcctgctgggggcc
aaccgcgccgaggcgcagcagcggcggctgctcgggagctacgagcagatgatggagcgg
ctgctggagatgcaggacggcgcctaccggcagcttcgggagactctggctgtggaggag
gaagtggctcagagccttcttgaactgaaagaatgtacgcgccagggggacaccgagctg
cagcagctggaggtggagctccagaggaccagcaaggaggacacctgtgtgcaggctagg
ctacgtcagctcatcacagagctgcaggagctcagggagatggaggaagagctccagcgc
caggagagggatgtagatgaggacaacaccgtcaccatcccctctgcagtgtatgtggct
catctctatcaccaaattagtaaaatacagtgggattatgaatgcgagccagggatgatc
aagggcatccaccacggccccacagtggcccagcccatccacttggacagtgcacagctc
tcgccgaagttcatcagtgactacctctggagcctggtggacaccacgtgggagccagag
ccttga

DBGET integrated database retrieval system