KEGG   Mus musculus (mouse): 67630Help
Entry
67630             CDS       T01002                                 

Gene name
Samd8, 1110053F04Rik, 1700010P07Rik, SMSr
Definition
(RefSeq) sterile alpha motif domain containing 8
  KO
K22697  sphingomyelin synthase-related protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67630 (Samd8)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    67630 (Samd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2_C SAM_1 PAP2 SAM_PNT SAM_2 PAP2_3
Motif
Other DBs
NCBI-GeneID: 67630
NCBI-ProteinID: NP_080559
MGI: 1914880
Ensembl: ENSMUSG00000021770
Vega: OTTMUSG00000027978
UniProt: Q9DA37 Q14AQ4
Position
14; 14 A3
AA seq 478 aa AA seqDB search
MPAGSRAGSRLRSGSLPRPSRLTLKALRPAYAPRTPDSNGDLDTGSELGPGSPAPTAEEV
EKEMAGPSQLCIRRWTTKHVAVWLKDEGFFEYVDILCNKHRLDGITLLTLTEYDLRSPPL
EIKVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMSPMTPFLSALQSADWLCNGEPTH
SCDGPIPDLSSDQYQYMNGKNKHSARRLDPEYWKTILSCVYVFIVFGFTSFIMVIVHERV
PDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGVILCYIWILVLLLHKHRSILLRRLCSLMG
TVFLLRCFTMFVTSLSVPGQHLQCTGKIYGSVWEKLRRAFAIWSGFGMTLTGVHTCGDYM
FSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITT
RLFLYYHTLANTRAYHQSRRARIWFPMFSFFECNVNGTVPNEYCWPFSKPAIMKRLIG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctggtagccgagccggctcccgcctgcgctccggctccctcccccggccttcg
cgtctgactctcaaggcgctgcgccccgcctacgcgccgaggacccccgactccaacggc
gacttagacaccggctccgagctgggtcccggcagcccggctcccaccgcggaggaagta
gagaaagaaatggcaggtcctagtcaactctgcattcgccgctggactaccaagcatgtg
gctgtgtggctgaaggacgaaggtttctttgagtatgtggacattttatgcaacaagcac
cgccttgatggaatcacattgctcacgctgactgaatatgatctccgctctcctcctctg
gaaatcaaagtcctaggagacattaaacggttaatgctctcagtccgaaaattgcagaaa
atacatactgatgttttggaagagatgggctacaacagtgacagtcctatgagtcccatg
actccattccttagtgctcttcagagtgcagactggctctgtaacggagagcccacacac
agctgtgatgggcccatccctgacttgagttctgatcagtaccagtacatgaatggcaaa
aacaaacattctgctcgaagactggacccagagtactggaagaccatcctgagttgtgta
tatgtttttatagtatttgggtttacgtctttcattatggttattgttcatgagcgtgtg
cctgacatgcagacctacccaccactcccagatatattcctagacagtgttcctaggatc
ccgtgggccttctccatgaccgaagtgtgtggcgtgattctgtgctacatttggatcctg
gttcttcttcttcacaagcacaggtcaatccttctgcgaaggctctgtagtctgatgggc
actgtattcttgcttcgctgctttaccatgtttgtgacctccctctccgtgccaggacag
cacctgcagtgtactggaaagatatatggaagtgtgtgggagaaactacgacgggcattt
gccatctggagcggctttggaatgactctgactggcgtccacacttgtggagactacatg
ttcagtggccacacagttgttctaaccatgctgaatttctttgtcacagagtatacacca
agaagctggaatttcttgcacactctatcctgggttctcaacctctttggaatcttcttc
atcttggctgcccatgaacattattccattgatgtgtttattgccttttatatcacaaca
agactctttttgtactaccatactctggctaacaccagagcgtatcatcagagtaggaga
gcgaggatttggttccctatgttttctttctttgaatgcaatgttaatggcacagtacct
aatgaatattgttggccattttctaaaccagcaataatgaaaagactaattggatga

DBGET integrated database retrieval system