KEGG   Mus musculus (house mouse): 67645
Entry
67645             CDS       T01002                                 
Symbol
Armc12, 4930511I11Rik, AV041658
Name
(RefSeq) armadillo repeat containing 12
  KO
K24168  armadillo repeat-containing protein 12
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    67645 (Armc12)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  Armadillo repeat domain-containing proteins
   67645 (Armc12)
SSDB
Motif
Pfam: Arm_2 HEAT_EZ V-ATPase_H_C
Other DBs
NCBI-GeneID: 67645
NCBI-ProteinID: NP_080566
MGI: 1914895
Ensembl: ENSMUSG00000024223
UniProt: Q80X86
Position
17:28749835..28757949
AA seq 340 aa
MGKTIPRFLEQLDLIKSFVGLATGAGALYLLYKAVRTGLKCHPPLCSNSPICIARLAIER
ERHGRDSGEIRRLLNSLDCKQDEYTRSMILHNITRCVYLLEAEASSCTMDDIDLVADMLD
EKDNSVKIQALNALKAFSGIRKFRLKIQEHCIKVLELISTIWDLELHVAGLRLLNNLPLP
DYVHPQLRRVMPALMEIIQSDCILAQVQAVRLLSYLAQKNDLLYDILNCQVRPNFLNLFQ
SSQPGSLLFEVLVFAEHLSEGRNATHYRAVKWHYNEQSLHEALFGDESRLADRLLSLVIH
PEEEVQIQACKVIVSLQCPQDLGSRPSSCRPSHSCFKTGK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggcaagaccattccccggttcctggagcaactggacctcatcaaaagcttcgtgggc
ctggctacaggcgccggggccttatacctgctgtacaaggccgtcaggactggcttaaaa
tgtcatccgccactctgctccaactcgccgatctgcattgcccgcctggccatcgagaga
gagcgccacgggcgggactccggtgagattcgaagacttctcaactctctagactgcaaa
caggatgagtataccaggagcatgatccttcataacatcacccgctgcgtgtacttgctg
gaggctgaggcctcttcttgtactatggatgacatcgacttggtggctgacatgctagat
gagaaggacaacagtgtaaaaatccaagctctgaatgcacttaaagctttctctggcatc
aggaaattcaggctcaaaatccaggagcattgcatcaaggtactggaactgatttccacc
atctgggacttggaattgcacgtagctggtctccgattgctcaacaacctcccgctacct
gactatgtgcacccacagctgcggcgggtgatgcctgccctgatggagatcatacagtca
gactgcatcctggcacaggtacaagctgtccgcctcctgagttacctggcacagaagaac
gaccttctttatgacattctcaactgtcaggtgcgtcccaacttcctgaacctcttccag
tcttcacagccgggcagtctgctgttcgaggtgctggtgtttgcggaacacttgagtgaa
ggtcggaacgccacccactaccgagcggtcaaatggcattacaacgagcaatccctgcac
gaagccctctttggggatgagtccagactggcagaccgactgctctccctggtcatccac
cctgaggaggaagttcagatccaggcctgcaaagtcatagtgagcttgcagtgtccccag
gacctgggatcccgaccctcttcctgccgacctagccattcctgctttaaaaccgggaag
tga

DBGET integrated database retrieval system