KEGG   Mus musculus (mouse): 67652
Entry
67652             CDS       T01002                                 

Gene name
Spaca1, 1700124L11Rik, 4930540L03Rik
Definition
(RefSeq) sperm acrosome associated 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Orf78 COX2_TM PRIMA1 YjcB
Other DBs
NCBI-GeneID: 67652
NCBI-ProteinID: NP_080569
MGI: 1914902
Ensembl: ENSMUSG00000028264
Vega: OTTMUSG00000008303
UniProt: Q9DA48 B1AWF2
Position
4; 4 A5
AA seq 305 aa
MRARGAGCPAGLLAVGWLILVGLQASQASNVTSSGGGVQEPAVAREGESESESESEEEAE
NEGEVPESETTAEADAEEEVQNRTIVKEVEFGMCTVTCGVGIREVILTNGCPGGESKCVV
RVEECRGPVDCGWGKPISENLDSARLSCVHISPENRFKYVWKLLKPDQQPVILTNDSAVL
EITREIRPLAFECDTLDNNEMVASVKFTVYTTNELQMRRSSRPDTDAVLVFVLTIGVIIC
IFVIFVLIFIIINWAAVKSFWGSKTSATEIQSELSSMRYKDSTSLDQSPTDIPVHEDDAL
SEWNE
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcgcgccaggggcgcaggctgccccgctgggctgctggccgtcggatggctgatcctg
gtgggcctgcaggcctcgcaggcatcgaatgtcacctccagcggcggaggcgtccaggaa
cccgctgtggcccgcgagggcgagagcgagagcgagagcgagagtgaggaggaggctgag
aacgaaggcgaagtgcccgagtccgaaaccacagccgaggccgatgccgaggaagaggtt
cagaacagaacaatagtcaaagaagtagaattcggaatgtgcacagtcacgtgtggtgtt
ggtatcagagaagtaattttaaccaatggatgccctggaggtgaatccaagtgtgttgtt
cgtgtggaagaatgccgtggacctgttgattgtggctggggtaaaccaatttctgaaaat
cttgatagtgctagactatcatgtgttcatatatctcctgaaaatcgtttcaaatatgta
tggaagcttctaaagccagaccaacaacctgttatactgacaaatgactcagcagtcttg
gaaataacgagagaaattcgtcctctggcttttgaatgtgacaccttggataataatgaa
atggtggcatctgttaaattcaccgtctatacaacaaatgaactgcagatgagaagatcc
agcagaccagacactgatgcagtcttagttttcgtgctgaccataggagtcattatctgc
atatttgtgatcttcgtattgattttcatcatcataaattgggcggcagtgaaatccttc
tgggggtcaaaaacttcagcaactgagatacagtccgagctgagctctatgaggtataaa
gattcgacgtctctcgaccagtcaccaacagatatacctgtacatgaagatgacgcttta
agtgaatggaatgaatga

DBGET integrated database retrieval system