KEGG   Mus musculus (mouse): 67669Help
Entry
67669             CDS       T01002                                 

Gene name
Hikeshi, 0610007P06Rik, 1110002N09Rik, l(7)6Rn, l7Rn6
Definition
(RefSeq) heat shock protein nuclear import factor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF775
Motif
Other DBs
NCBI-GeneID: 67669
NCBI-ProteinID: NP_080580
MGI: 96738
Ensembl: ENSMUSG00000062797
Vega: OTTMUSG00000023022
UniProt: Q9DD02
Position
7 D3; 7 50.4 cM
AA seq 197 aa AA seqDB search
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPD
SNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDS
LAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKW
YENFQRRLAQNPLFWKT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctgcctggtggcggggaggctggtgcaaacagctgcacagcaagtggcagag
gataaatttgtttttgacttgcctgattatgaaaatatcaaccatgttgtggtttttatg
ctgggaacaatcccatttcctgagggcatgggaggatctgtctacttttcctatcctgat
tcaaatggggtgccagtgtggcagctcctaggatttgtcacgaatggaaagccaagtgcc
atcttcaaaatatcaggtcttaaatctggggaaggaagccagcacccatttggagccatg
aatattgtgcgaaccccatctgttgcccagattggcatctcggtggaattgttggacagt
ctggctcagcagactcctgtaggcagtgctgccgtgtcctccgttgactcctttacgcag
ttcacacagaagatgttggacaacttctacaattttgcttcatcatttgctctctctcag
gcccagatgacaccaaatccatcagaaatgttcatcccagcaaatgtggttctgaaatgg
tatgaaaactttcaaagacgactagcacagaaccccctcttttggaaaacataa

DBGET integrated database retrieval system