KEGG   Mus musculus (mouse): 67669
Entry
67669             CDS       T01002                                 

Gene name
Hikeshi, 0610007P06Rik, 1110002N09Rik, Hike, l(7), l(7)6Rn, l7, l7Rn6
Definition
(RefSeq) heat shock protein nuclear import factor
  KO
K23327  protein Hikeshi
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    67669 (Hikeshi)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   67669 (Hikeshi)
SSDB
Motif
Pfam: DUF775
Other DBs
NCBI-GeneID: 67669
NCBI-ProteinID: NP_080580
MGI: 96738
Ensembl: ENSMUSG00000062797
Vega: OTTMUSG00000023022
UniProt: Q9DD02
Position
7 D3; 7 50.4 cM
AA seq 197 aa
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPD
SNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDS
LAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKW
YENFQRRLAQNPLFWKT
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtttggctgcctggtggcggggaggctggtgcaaacagctgcacagcaagtggcagag
gataaatttgtttttgacttgcctgattatgaaaatatcaaccatgttgtggtttttatg
ctgggaacaatcccatttcctgagggcatgggaggatctgtctacttttcctatcctgat
tcaaatggggtgccagtgtggcagctcctaggatttgtcacgaatggaaagccaagtgcc
atcttcaaaatatcaggtcttaaatctggggaaggaagccagcacccatttggagccatg
aatattgtgcgaaccccatctgttgcccagattggcatctcggtggaattgttggacagt
ctggctcagcagactcctgtaggcagtgctgccgtgtcctccgttgactcctttacgcag
ttcacacagaagatgttggacaacttctacaattttgcttcatcatttgctctctctcag
gcccagatgacaccaaatccatcagaaatgttcatcccagcaaatgtggttctgaaatgg
tatgaaaactttcaaagacgactagcacagaaccccctcttttggaaaacataa

DBGET integrated database retrieval system