KEGG   Mus musculus (mouse): 67674Help
Entry
67674             CDS       T01002                                 

Gene name
Trmt112, 0610038D11Rik, Trm112p
Definition
(RefSeq) tRNA methyltransferase 11-2
  KO
K15448  multifunctional methyltransferase subunit TRM112
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    67674 (Trmt112)
   03012 Translation factors [BR:mmu03012]
    67674 (Trmt112)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    67674 (Trmt112)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Release factors
   67674 (Trmt112)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trm112p
Motif
Other DBs
NCBI-GeneID: 67674
NCBI-ProteinID: NP_001159842
MGI: 1914924
Ensembl: ENSMUSG00000038812
Vega: OTTMUSG00000038206
UniProt: Q9DCG9 Q5M8M3
Position
19; 19 A
AA seq 125 aa AA seqDB search
MKLLTHNLLSSHVRGVGTRGFPLRLQATEVRINPVEFNPEFVARMIPKVEWAALVQAADT
LNLAEVPKEPTEGYEHDETFLRKMHHVLLEVDVLEGTLQCPESGRLFPISRGIPNMLLND
EETET
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctcacccacaatctcctaagctcccatgtgcggggcgtgggcacgcgtggc
ttcccgctgcgcctgcaggccactgaggtccgcatcaaccccgtggagttcaacccggag
ttcgtggcgcggatgatccccaaagtggagtgggcggcgcttgtgcaggcagcggacacc
ttaaacttggccgaggtacccaaagagccgactgaaggctatgagcacgacgagacattt
ttgaggaagatgcaccacgtgttgcttgaggttgatgtactggagggcaccctgcaatgc
ccagaatctggtcgtcttttccccatcagccgcgggatccccaatatgctgttgaatgat
gaggagactgagacgtaa

DBGET integrated database retrieval system