KEGG   Mus musculus (mouse): 67678
Entry
67678             CDS       T01002                                 

Gene name
Lsm3, 1010001J12Rik, 2610005D18Rik, 6030401D18Rik, SMX, SMX4, US, USS2
Definition
(RefSeq) LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12622  U6 snRNA-associated Sm-like protein LSm3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    67678 (Lsm3)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    67678 (Lsm3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67678 (Lsm3)
   03041 Spliceosome [BR:mmu03041]
    67678 (Lsm3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     67678 (Lsm3)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     67678 (Lsm3)
Spliceosome [BR:mmu03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    67678 (Lsm3)
 Complex C
  U2 snRNP components
    67678 (Lsm3)
SSDB
Motif
Pfam: LSM vATP-synt_E DUF150_C
Other DBs
NCBI-GeneID: 67678
NCBI-ProteinID: NP_080585
MGI: 1914928
Ensembl: ENSMUSG00000034192
Vega: OTTMUSG00000024129
UniProt: P62311
Position
6; 6 D1
AA seq 102 aa
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEET
VTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
NT seq 309 nt   +upstreamnt  +downstreamnt
atggcggacgacgtagatcagcaacagaccaccaataccgtagaggagcccctggatctg
atcaggctcagcctggatgagcgaatttatgtgaaaatgagaaatgaccgagagcttcga
ggcagactacacgcttatgatcaacatttaaatatgatcctgggagatgtagaagaaact
gtgacaacgatagagattgatgaggagacatatgaagagatatataaatccacaaaacga
aacatccctatgctcttcgtccggggagatggcgtcgttctagtcgcccctccattgaga
gttggctga

DBGET integrated database retrieval system