KEGG   Mus musculus (mouse): 67693Help
Entry
67693             CDS       T01002                                 

Gene name
Hypk, 2310003F16Rik, HSPC136
Definition
(RefSeq) huntingtin interacting protein K
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4758
Motif
Other DBs
NCBI-GeneID: 67693
NCBI-ProteinID: NP_080594
MGI: 1914943
Ensembl: ENSMUSG00000027245
Vega: OTTMUSG00000015324
UniProt: Q9CR41
Position
2; 2 E5
AA seq 129 aa AA seqDB search
MRRRGEIEMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNL
ETAMSVIGDRRSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNV
VEALIALTN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcgcggtgagatcgaaatggcgaccgagggagacgtggagttggagttagag
accgagaccagcggcccggagcggcctcccgagaagccaaggaaacatgacagtggtgct
gctgacctagagcgggttactgactatgcggaggagaaggagatccagagttcgaatctt
gaaacggctatgtccgtcattggagacagacggtccagggaacaaaaggccaaacaagag
cgggagaaggaactggcgaaggtcactatcaagaaggaagatctggagttgataatgacg
gaaatggagatctctcgagcagcagcagaaaggagcttgagggaacacatgggcaatgtg
gtggaggctcttattgccctaaccaactga

DBGET integrated database retrieval system