KEGG   Mus musculus (house mouse): 67707
Entry
67707             CDS       T01002                                 
Symbol
Mrpl24, 2010005E08Rik, 2810470K06Rik, 6720473G22Rik
Name
(RefSeq) mitochondrial ribosomal protein L24
  KO
K02895  large subunit ribosomal protein L24
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    67707 (Mrpl24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    67707 (Mrpl24)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    67707 (Mrpl24)
  Bacteria
    67707 (Mrpl24)
  Archaea
    67707 (Mrpl24)
SSDB
Motif
Pfam: ribosomal_L24 KOW
Other DBs
NCBI-GeneID: 67707
NCBI-ProteinID: NP_080867
MGI: 1914957
Ensembl: ENSMUSG00000019710
UniProt: Q9CQ06
Position
3:87825438..87830757
AA seq 216 aa
MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGD
MVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDHRGTMIASEAPLLHHQV
KLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVE
DALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcggctctcagccctgctggccttggcatccaaagccacttcctcccccttctaccgc
tatggaatgagccgtccaggttccatagcagacaaaaggaagaatcctccatggagcagg
cggcgcccagtagtggtagagcccatctctgatgaagactggcacctattctgtggagac
atggtagaaatcttagaaggcaaggatgctgggaagcaaggcaaagtagtccaagtcgtt
cggcagcgaaactgggttgtcctggaggggttgaacacgcattaccgatacattggcaga
accaaggaccaccgagggaccatgatcgctagtgaagcccccttgcttcatcaccaggtc
aagctagtggatcctgtggacaggaaacccactgagatccagtggagatttactgaggca
ggagaacgtgttcgagtctctacaagatctggcagaattatccccaaacctgaatttcct
agagcagatggcattgtccctgaaacatggactgatggccccaaggacacatcagtggaa
gatgctcttgaaagaacttatgtgccccgactaaagacattagaagaagatgtgatggag
gccatggggatccaggagactcgaagattcaagaaagtttattggtattga

DBGET integrated database retrieval system