KEGG   Mus musculus (mouse): 67710
Entry
67710             CDS       T01002                                 

Gene name
Polr2g, 2410046K11Rik, A230108L04Rik, C76415, RB, RBP7, Rpo, Rpo2-7l
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide G
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    67710 (Polr2g)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    67710 (Polr2g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    67710 (Polr2g)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67710 (Polr2g)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    67710 (Polr2g)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     67710 (Polr2g)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     67710 (Polr2g)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      67710 (Polr2g)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 67710
NCBI-ProteinID: NP_080605
MGI: 1914960
Ensembl: ENSMUSG00000071662
UniProt: P62488
Position
19; 19 A
AA seq 172 aa
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttatcacatttccctggagcacgagatcctcctgcacccacgatacttcggtcca
aacttgctcaacacggtgaagcagaagctgtttaccgaggtggaggggacctgcactggg
aaatatggctttgtaattgctgtcaccaccatcgacaatattggtgctggtgtgatccag
ccaggccgaggttttgttctttatccagtgaaatacaaagctattgttttccggcccttt
aaaggtgaagtggtggatgctgtggtcactcaggtcaacaaggttggacttttcacagaa
attgggcctatgtcttgcttcatctctcgacattccatcccttcagagatggagtttgat
ccaaattcaaaccccccttgctataagaccatggacgaggacattgtgattcagcaggac
gatgagatacgcttgaagattgtaggcacgcgtgtagacaagaatgacatttttgccatt
ggctctctgatggacgactacttggggctcgtgagctga

DBGET integrated database retrieval system