KEGG   Mus musculus (mouse): 67712
Entry
67712             CDS       T01002                                 

Gene name
Slc25a37, 1700020E22Rik, 4930513O14Rik, 4930526G11Rik, AI848481, C330015G08Rik, Fra, Mf, Mfr, Mfrn, Mfrn1, Ms, Mscp, frascati, mito, mitoferrin
Definition
(RefSeq) solute carrier family 25, member 37
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    67712 (Slc25a37)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67712 (Slc25a37)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    67712 (Slc25a37)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   67712 (Slc25a37)
SSDB
Motif
Pfam: Mito_carr SLC25_like
Other DBs
NCBI-GeneID: 67712
NCBI-ProteinID: NP_080607
MGI: 1914962
Ensembl: ENSMUSG00000034248
Vega: OTTMUSG00000044494
UniProt: Q920G8 Q9CQG7
Position
14; 14 D2
AA seq 338 aa
MELRRGGVGNQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEH
SIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAM
YFACYENMKRTLNDVFSHQGNSHLANGVAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQS
AFSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYILTKRQLENRTLY
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggagctccgccgtggcggcgtggggaaccaggctgcgggccggaggatggatggggac
tgccgcgatggcggctgcggcagcaaggacgccgggtcggaggactacgagaacctaccg
accagcgcctcggtgtccacccacatgacagcgggagcgatggccgggattctggagcac
tccatcatgtacccggtggactccgtgaagacacggatgcagagtttgaatccagatccc
aaagcccggtatacaagcatctatggcgccctcaagaggatcatgcacactgaaggcttc
tggaggcccctgcggggcctgaacgtgatgatgatgggtgcagggcccgcgcacgccatg
tattttgcctgctatgaaaacatgaaaaggactttaaatgacgttttcagccaccaagga
aacagccatctagctaatggggtagctgggagtatggccaccctactccacgatgcagta
atgaatccagcagaagtggtgaaacagcgcttacagatgtacaactcccagcaccagtca
gccttcagttgtatccggacagtgtggcggaccgaggggttgggggccttctacaggagt
tacaccacacagctgaccatgaatatccccttccagtcaattcacttcatcacctatgag
tttctgcaggagcaagtcaaccctcgccgggactacaacccacagtctcacatcatctca
ggaggcctggccggggcactggccgcagctgccaccaccccgctggacgtctgcaaaacc
ctcctcaacacgcaggagaacatggctctctccctggccaacgtcagcggccggctgtcg
ggcatggccaatgccttccggacggtgtaccagctcaacggccttgccggctatttcaaa
ggcatccaggctcgagtcatctaccagatgccttccaccgccatctcctggtccgtttat
gagttcttcaagtacatccttacaaagaggcagctggagaatcgaactctgtactaa

DBGET integrated database retrieval system