KEGG   Mus musculus (mouse): 677156
Entry
677156            CDS       T01002                                 

Gene name
Cyp4f37, Gm9705
Definition
(RefSeq) cytochrome P450, family 4, subfamily f, polypeptide 37
  KO
K00490  cytochrome P450 family 4 subfamily F [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    677156 (Cyp4f37)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     677156 (Cyp4f37)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   677156 (Cyp4f37)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 677156
NCBI-ProteinID: NP_001093657
MGI: 3780112
Ensembl: ENSMUSG00000062464
UniProt: Q3V1F1
Position
17 B1; 17
AA seq 546 aa
MLRLSVSGLDLGSVVTLSWHLLLLGAASWILARILAWTYSFCENCSRLRCFPQPPKRNWF
LGHLGMIEHNEEGMQLMTEAGQTYRDVHLCWLGPVIPVLRIVDPAFVAPLLLASALVAPK
DTTFHTFVKPWLGDGLFLNSGDKWSRHRRLLTPAFHFDILKPYVKIFNQSVNIMHAKWKH
LSSEGSARLEMFEHISLMTLDSLQKCLFGFDSNCQESPSEYISAILELSSLVIKRSHQLF
LFVDFLYYHTADGRRFRKACDLVHNFTDAVIRERRHTLSSQNHDEFLKSKTKSKTLDFID
VLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVQE
LLRGREPQEIEWDDLAQLPFLTMCIKESLRLHPPVIDLLRRCTRDIVLPDGRVIPKGNIC
VISIFGIHHNPSVWPDPEVYDPFRFDPENAHKRPPLAFIPFSAGPRNCIGQTFAMNEMMV
ALALTLLRFRILPDDKEPRRKPEIILRAEGGLWLRVEPLSTVLKDSKPDLEASLPHPPIV
LSGSQN
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgctgcggctaagtgtgtctgggctggacctgggctctgtggtgaccttgtcatggcat
cttctgctgcttggagcggcatcttggattttggccagaatccttgcctggacttactca
ttctgtgagaactgctcccgcctcagatgtttccctcagcctcctaaaagaaactggttt
ttgggtcacttgggcatgattgagcacaatgaggaaggcatgcagctgatgactgaagca
ggccagacttaccgagatgtccatctctgttggctgggaccagtgatccctgtgctgagg
attgttgaccctgcatttgttgcccccctgctcctggcctcagctttggtggccccaaag
gacacgactttccatacctttgtgaagccctggctgggggatgggctcttcctgaattca
ggtgacaagtggagccgccatcgccgtctgctgacacctgccttccactttgacatcctg
aagccctatgtgaagatatttaaccagagtgtgaacatcatgcacgccaagtggaagcac
ctatcctcggaaggcagtgcacgtctggaaatgtttgagcacatcagcctcatgaccttg
gacagtctgcagaaatgcctctttggctttgacagcaactgtcaggagtctcccagtgaa
tacatttctgccatcttggaactcagctccctcgtaataaaaaggtcacatcagctcttc
ttgttcgtggacttcctgtattaccacactgctgatgggcggcgcttccgcaaggcctgt
gacctggtgcacaacttcacagatgctgtcattagggagagacggcacactctctccagc
caaaaccatgatgagttcttgaagtccaagactaagtctaagactctggacttcattgac
gttctcttgttggccaaggatgaacatggaaaggagctgtcagatgaggacatccgggca
gaggctgacacctttatgtttggaggccatgacacgacagccagtgcactctcctggatc
ctgtacaacctggcgaggcaccccgaataccaggagcgctgccggcaggaggttcaggag
ctgctgaggggccgagagccccaggagattgaatgggacgacctggcccagctacccttc
ctgaccatgtgcatcaaggagagtctgcggctgcatcccccagtcatagatctcctccgc
cgctgcacccgggacattgtgctacctgatggccgggtcatccctaaagggaacatctgt
gtcatcagcatctttggtattcatcacaatccatcagtctggccagaccctgaggtctat
gaccccttccgctttgacccagaaaacgcacacaagaggcctcctctggcttttattccc
ttttctgccgggcccaggaactgcataggacagactttcgctatgaatgagatgatggtg
gcactggcgttgactctgctgcgcttccgcatcctgccggatgacaaggagccgcgccgg
aagccagagataatcctgcgggcggagggcgggttgtggctgcgggtggagccgctgagc
acagtgctgaaggactccaaacctgaccttgaggcttctttaccccaccctccaattgtt
ctctccggttctcagaattag

DBGET integrated database retrieval system