KEGG   Mus musculus (house mouse): 67725
Entry
67725             CDS       T01002                                 
Symbol
Nudt13, 4933433B15Rik
Name
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 13
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NUDIX-like NUDIX zf-NADH-PPase
Other DBs
NCBI-GeneID: 67725
NCBI-ProteinID: NP_080617
MGI: 1914975
Ensembl: ENSMUSG00000021809
UniProt: Q8JZU0
Position
14:20344709..20367652
AA seq 352 aa
MSLYCRTFFRRKSFGCYRLLSTYVTKARYLFELKEDEEACRKAQKTGVFYLFHDLDPLLQ
ASGHRYLVPRLSRAELEGLLGKFGQDSQRIEDSVLVGCSEQQEAWFALDLGLKSASSSRA
SLPKSEMEAELGGSFIKLRQALFQLNSVDSSLLFTAQALLRWHDGHQFCSKSGQPTQKNV
AGSKRVCPSSKIIYYPQMAPVVITLVSDGARCLLARQSSFPKGLYSALAGFCDIGESVEE
TVHREVAEEVGLEVENIQYSASQHWPFPNSSLMIACHATVKPGHTEIQVNLKELEAAAWF
SLDEVTTALRRKGSLALQPSEASPLLLPPKLAIAHHLIKKWVETRSCSSLAA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgtctctgtattgtagaacatttttcaggaggaaatcttttgggtgctataggctgctg
tcaacctatgtcactaaggcacgatacttatttgaattgaaggaagatgaagaggcctgc
aggaaggctcagaagacaggagtgttttacctctttcatgacctggatcctttgctccag
gcgtcaggacatcgatacctggtgccccggcttagccgagcagagttggaagggctgctg
ggtaagttcggacaggattcgcaaagaattgaagattcggtgctggttgggtgctccgag
cagcaggaagcatggtttgctttggatctaggtctgaagagtgcctcctccagccgtgcc
tccttgccgaaatctgaaatggaagcagagctgggaggttctttcatcaagctgaggcag
gctcttttccagctgaactcggtggactcctccttgctgttcacggctcaggctcttctc
cgctggcatgacggtcatcagttctgcagcaaaagtgggcagcccacccagaagaacgtg
gcgggcagcaagcgagtgtgtccctccagtaaaatcatctattatccacagatggcgccc
gtagtgatcacactggtgtcagatggggcccgctgcctacttgcccgccagagttccttt
cccaaggggttatattctgccctggcaggtttctgtgacataggtgaaagtgtggaagaa
actgtccatcgagaagttgcggaagaggtgggcctggaagtggaaaacatacagtactct
gcgtcccagcactggccctttcccaatagctcactcatgatcgcttgtcacgcaaccgtg
aaaccaggacacacagagattcaggtgaacttgaaggaactagaggcagccgcctggttc
agtcttgatgaggtgaccacagccctgaggagaaagggctccttggctctgcagccgagt
gaggcttccccactgttgctgcctcccaagttagccattgcccaccacttgattaagaag
tgggtggagacgcggagctgttcttccctggctgcttag

DBGET integrated database retrieval system