KEGG   Mus musculus (house mouse): 67726
Entry
67726             CDS       T01002                                 
Symbol
Fam114a2, 1810073G14Rik, 9030624B09Rik
Name
(RefSeq) family with sequence similarity 114, member A2
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF719 NPIP Med8
Other DBs
NCBI-GeneID: 67726
NCBI-ProteinID: NP_001162139
MGI: 1917629
Ensembl: ENSMUSG00000020523
UniProt: Q8VE88
Position
11:complement(57373816..57409482)
AA seq 497 aa
MSDKDPPESPVVTGVASTLKDENCEPVEKPEDKSQPVVSTRKRPETKPSSDLEASALPAQ
VSLAVAKETASKDVPQTGWGYWGSWGKSLLSSASATVATVGQGISNVIEKAETSLGIPSP
TEISAEVKQAAGEKNAGENGSLLVAAPFGMLSTISTAVQSTGKSVISGGLDALEFIGKKT
MDVIAEGDPGFKRTKGLMNRTSTLSQVLREAKDKEEQRPSNEVTMETDKKTHYGLLFDEF
QGLSHLEALEMLSRESEIKVKSILSSLSGEELQTTRLELEQLKEVFSLAEFCEEEEEERQ
GDDNFTKEITDLFAQLHVSSRPEKLARARNTAYKWIRTSLARPVAEKEEGEKESEAGNTE
EAQKHSIEDIHAFAIRSLAELTACSIELFHKTAALVLHGQKQEVTALERSQTLSQMTVML
CKDLASLSKEFTTCLTTAGVREKADVLNPVITAVFLEASNSASYIQDAFQLLLPVLQISL
IESKTESSTCEPQSRDL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtcagataaggatcctccagagtctccagtggtaaccggagtagcttcgacccttaaa
gatgagaactgtgagccagtggagaagccagaggataaatctcagcctgtagtgtccacc
cggaaaagaccagagaccaaaccttccagtgaccttgaggcttctgctcttcctgctcag
gtttcactggctgtagccaaagagactgcttctaaagatgtacctcagactgggtggggt
tattggggcagttggggcaagtctctgctctcctcagcctcagctacggtagctacagta
ggacaaggtatttcaaatgtcattgagaaggcagagacttctcttgggattcctagcccc
actgaaatttcagctgaagtcaagcaagcagcaggagaaaaaaatgctggtgagaatgga
agcttactagtggctgcaccattcgggatgctctcgaccatctctacagctgtgcagagc
acgggcaagagcgttatcagtgggggcttggatgccttggaattcattgggaagaagaca
atggatgtcatagcagaaggggaccctggatttaaaagaaccaagggcctgatgaatcgg
acttctacgctgtctcaggttttacgagaggcaaaggataaagaagagcagcggccttcc
aatgaagtaaccatggaaacagacaagaaaactcattatgggctactctttgatgagttt
caaggcctttcacatctagaagctctggagatgctttcccgagaaagtgagataaaggtg
aaatctattcttagttctctgagtggagaagaactacagacaactagacttgagctagag
cagctcaaagaagtgttttccctagcagagttctgtgaggaagaggaggaggagagacaa
ggggatgacaattttaccaaggagataacagatctgtttgctcagcttcacgtctcctcc
cgaccagagaagcttgccagggcaagaaatacagcctacaaatggatcagaacatctctg
gctaggccagtagcagagaaagaagaaggagaaaaagagtcggaggcaggaaataccgag
gaagcccagaaacattcaatagaggatatccatgcatttgcaatccggagcttagcagag
ttgactgcctgctcaatagaattgttccacaaaacagcagcattggttttgcatggccag
aagcaggaggtgacagccttagagaggagccagactctctcccagatgacagtcatgctg
tgtaaagacctggcctcgctgtctaaagagttcaccacctgcctgaccacagctggggtc
agagagaaggcagatgttcttaatccagtcatcactgcagtgtttctagaggcctcaaac
agcgcctcttacattcaagatgccttccaactcctcctgcctgtgctgcagatctctctc
atcgagagcaagacagagtcatccacgtgtgagccacagtccagagacctctga

DBGET integrated database retrieval system