KEGG   Mus musculus (mouse): 677296
Entry
677296            CDS       T01002                                 

Gene name
Fcrl6, FcRH6, mIFGP6, moFcRH6
Definition
(RefSeq) Fc receptor-like 6
  KO
K17273  Fc receptor-like protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    677296 (Fcrl6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   677296 (Fcrl6)
SSDB
Motif
Pfam: Ig_2 Ig_3 Ig_C17orf99 ig Ig_4
Other DBs
NCBI-GeneID: 677296
NCBI-ProteinID: NP_001158197
MGI: 3618339
Ensembl: ENSMUSG00000070504
Vega: OTTMUSG00000050154
UniProt: A1YIY0
Position
1; 1 H3
AA seq 268 aa
MLLWMVLLLCESMAEAQELFPNPELTEFTNSETMDVILKCTIKVDPKNPTLQLFYTFYKN
NHVIQDRSPHSVFSAEAKEENSGLYQCMVDTEDGLIQKKSGYLDIQFWTPVSHPVLTLQH
EATNLAVGDKVEFLCEAHQGSLPIFYSFYINGEILGKPLAPSGRAASLLASVKAEWSTKN
YSCEAKNNISREISELKKFPLVVSGTAWIKSNMLPIWLPASLLGGMVIAAVVLMYFFKPC
KKHARPETPTLKEPDSFLYVSVDNQRYK
NT seq 807 nt   +upstreamnt  +downstreamnt
atgctgctctggatggttctcctgctctgtgagtccatggctgaagctcaagagttgttc
ccaaatcctgagctgacagaattcaccaattcagagacgatggatgtcatcctgaagtgt
accataaaggtggaccccaagaatccaactttacagctcttttacactttctacaagaac
aaccatgtcattcaagacaggagtccccactcagtattttctgcagaagccaaggaggaa
aactctgggctctaccagtgtatggtggacactgaggatggcttaattcagaaaaaaagt
ggctatctggatatccagttctggactcctgtatcccatcctgtgctcactctgcaacat
gaagccactaaccttgctgtaggagacaaggtggagttcctctgtgaggcccaccagggc
tcccttccaatcttttactcattctacattaatggagaaatcctagggaaacccctggct
ccctctggcagagctgcctccctcctcgcctcagtaaaggcagagtggagtaccaagaac
tattcctgtgaagctaaaaacaacatctccagagaaataagtgagctcaagaagttcccc
ttggttgtctcaggtactgcctggatcaagagcaacatgctacctatctggctacctgca
agcctgcttggagggatggtcattgcggctgtggttctaatgtatttcttcaaaccctgt
aaaaagcatgccagacctgagacgcccaccctaaaagagccagacagttttctatatgta
tcggttgataatcaaagatataaatga

DBGET integrated database retrieval system