KEGG   Mus musculus (house mouse): 67733
Entry
67733             CDS       T01002                                 
Symbol
Itgb3bp, 4930471O16Rik, CENP-R
Name
(RefSeq) integrin beta 3 binding protein (beta3-endonexin)
  KO
K11510  centromere protein R
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67733 (Itgb3bp)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     67733 (Itgb3bp)
SSDB
Motif
Pfam: CENP-R ATP-gua_PtransN
Other DBs
NCBI-GeneID: 67733
NCBI-ProteinID: NP_080624
MGI: 1914983
Ensembl: ENSMUSG00000028549
UniProt: Q9CQ82
Position
4:complement(99655643..99717403)
AA seq 176 aa
MPVKRSLKLDDQFEKNSFSPSKIVRKKSITAYSPTTGTYQLSPFSSPATPKEQEHRNGPS
NETRKRSNLSSPVRQESTVKDRDGFMVLLSKIEISSEKTMEIMKNLSSIQALEGNRQLED
LIGVSLVPCSLKSEARKTKELMTKVIKQKLFEKKKSRITPKDHHLDSFEFLKAILN
NT seq 531 nt   +upstreamnt  +downstreamnt
atgccagttaaaagatcactgaaactggatgatcagtttgaaaaaaattcatttagtcct
tcaaaaatcgtgaggaagaaaagtattacagcttattctcctactactggaacttatcag
ttgagcccattttcttctcccgcaacccccaaagaacaggagcacagaaacggaccatca
aatgaaacaaggaaacggagtaacttgagctcacctgtaagacaggagtccacagtgaaa
gacagggatggattcatggtgttgctatctaaaattgagatatcatcagagaaaaccatg
gagataatgaaaaatctaagtagtatacaggctttggagggcaacagacaacttgaagat
ctcattggtgtttccctagtaccatgctccttaaaaagtgaagcaaggaaaaccaaagaa
ctaatgactaaagtaataaaacaaaagttgtttgaaaagaaaaaatcaagaattactccc
aaagatcatcatcttgacagctttgaattccttaaagccattttgaactga

DBGET integrated database retrieval system