KEGG   Mus musculus (mouse): 67738
Entry
67738             CDS       T01002                                 

Gene name
Ppid, 4930564J03Rik, CYP-4, CYP-40, P, Ppidl
Definition
(RefSeq) peptidylprolyl isomerase D (cyclophilin D)
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    67738 (Ppid)
   04218 Cellular senescence
    67738 (Ppid)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    67738 (Ppid)
   05022 Pathways of neurodegeneration - multiple diseases
    67738 (Ppid)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    67738 (Ppid)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     67738 (Ppid)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    67738 (Ppid)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_12 TPR_11 TPR_19 TPR_16 TPR_8 TPR_9 TPR_17
Other DBs
NCBI-GeneID: 67738
NCBI-ProteinID: NP_080628
MGI: 1914988
Ensembl: ENSMUSG00000027804
Vega: OTTMUSG00000029417
UniProt: Q9CR16
Position
3; 3 E3
AA seq 370 aa
MSHASPAAKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGS
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARTLENVEVNGEKPAKLCVIAE
CGELKEGDDWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWE
MAIKKYAKVLRYVDSSKAVIEKADRSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
EMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDK
EKAVYAKMFA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcccacgcatccccggcagccaagccctccaactccaagaacccgcgagtcttcttt
gacgtggacatcggcggggagcgagttggccgaattgttttagaattgtttgcagatatt
gttcccaaaactgcagaaaattttcgtgcgttgtgtacaggagaaaaaggaactgggtcc
acgaccgggaagcctctccattttaaaggatgccctttccaccgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggcgaaagtatttatggt
gaaaaatttgaagatgaaaattttcattataagcatgatcgggagggtttgctgagcatg
gcaaatgcaggccccaatacgaatggctctcagttctttatcacaacagttccgactcct
catctggacgggaaacatgtggtatttggtcaggtcataaaaggactaggtgtggcaagg
acgcttgaaaatgtagaggtgaatggtgaaaaacctgccaaactctgtgttattgcagaa
tgtggagaattgaaagaaggggatgactggggaatcttccccaaagatggctctggtgac
agtcatccagacttccctgaggatgcagatatagatttaaaagatgtagataaaatttta
ttaatatctgaagacttaaaaaacattggaaatacttttttcaagtctcagaactgggag
atggctattaaaaaatatgcgaaggttttaaggtatgtggatagttcaaaggctgttatt
gagaaagcagatagatccagactgcaacctatagccttaagttgtgtgctgaatattggt
gcttgtaagctgaagatgtcaaattggcagggggcaattgacagttgcttagaggctctt
gaaatggacccttcaaatactaaagcactataccgaaaagcgcaaggatggcaaggattg
aaagaatatgatcaagcattggctgatcttaagaaggcacaggagatagccccaggagat
aaagctatccaggcagaattgcttaaagtcaaacaaatgataaaggcacagaaagataaa
gagaaggccgtgtatgcaaaaatgtttgcttaa

DBGET integrated database retrieval system