KEGG   Mus musculus (mouse): 67758
Entry
67758             CDS       T01002                                 

Gene name
Aadac, 5033417E09Rik, A, AI265437, Aada
Definition
(RefSeq) arylacetamide deacetylase
  KO
K13616  arylacetamide deacetylase [EC:3.1.1.3]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    67758 (Aadac)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     67758 (Aadac)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   67758 (Aadac)
SSDB
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Esterase_PHB Say1_Mug180 Chlorophyllase2
Other DBs
NCBI-GeneID: 67758
NCBI-ProteinID: NP_075872
MGI: 1915008
Ensembl: ENSMUSG00000027761
Vega: OTTMUSG00000022631
UniProt: Q99PG0
Position
3; 3 D
AA seq 398 aa
MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGELLGISHFMET
IQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSMALRRGLFYIHGGGWCLGSAA
HFSYDTLSRWTAHKLDAVVVSTDYGLAPKHHFPRQFEDVYRSLRWFLQEDVLEKYGVDPR
RVGVSGDSAGGNLAAAVTQQLIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVL
TRSLMVRFWSEYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPT
PGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLMYVKRLQNVGV
HVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggggaaaaccatttctcttctcatctctgtggtgcttgtagcttattatctttatata
ccgcttccagatgctattgaagagccttggaaggtagtatgggaaactgcctttgtaaag
ataggaacagatttggcttcatttggtgaacttttgggaatcagtcatttcatggaaacg
atacagttacttatgagttttcaagaagtcccacccacgtctgatgagcatgtcactgtg
atggagacagctttcgacagtgttcccgtccgcatatacatacccaaaagaaagtcaatg
gctctcaggcggggcttgttttatattcatggtggtggctggtgtttggggagtgctgct
cacttctcctatgacactctatcgagatggacagcccataaacttgatgctgttgttgtg
tcaactgactatggcttagccccaaaacaccattttccaagacagtttgaagatgtgtat
cgtagtttacgatggttcttacaagaggacgtccttgaaaaatatggtgtagatcctagg
agagtcggtgtgtctggagacagtgctggtggaaacttagccgcagctgtgacccaacag
cttatacaagatccagatgtcaagatcaaactcaaggtccaagccttaatatatcctgcc
cttcaggctcttgatacgaatgtaccatcacaacaagaaggttcccattttccagtttta
accaggtcattaatggtcaggttctggagtgaatactttactacagaccgaggcctggaa
aaagccatgcttctcaaccaacatgtacccatggaatctagccacttgttacagtttgtg
aattggagttccttgctccctgagagatacaagaaaagtcccgtttacaaaaatcccact
cctggtagttctgagctggctcaaaagtatccagggttcatagatgtgaaggcatgccct
ctgttggccaatgacaatatattgcatcatttacctaagacctatatcatcacttgccag
tatgatgtcctaagagatgatggactcatgtatgtcaagcggcttcagaatgttggagtt
catgtgactcatcaccatgtggaagatggattccatggaacgttttcctttcctggttta
aaactttcagagaggatgaaaaatcagtacttgagttggcttatcaaaaatctgtaa

DBGET integrated database retrieval system