KEGG   Mus musculus (mouse): 67767
Entry
67767             CDS       T01002                                 

Gene name
Jagn1, 5830427H10Rik
Definition
(RefSeq) jagunal homolog 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Jagunal DUF588 DUF3810
Other DBs
NCBI-GeneID: 67767
NCBI-ProteinID: NP_080641
MGI: 1915017
Ensembl: ENSMUSG00000051256
Vega: OTTMUSG00000023562
UniProt: Q5XKN4
Position
6; 6 E3
AA seq 183 aa
MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHL
RLLSHDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSM
EMFPAAQQLYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEK
KRK
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcgtctcgggcaggcccgcgagcggccggcaccgacggcagcgactttcagcaccgg
gagcgcgtcgccatgcactaccagatgagtgtgaccctcaagtacgaaatcaagaagctg
atctacgtgcatctcgtcatatggctgctgttggtggccaagatgagcgtgggacacctg
aggctcttgtcacatgatcaggtggccatgccctatcagtgggaatatccgtatttgttg
agcattgtgccctctgtcttgggcctgctctccttccctcggaacaacattagctacctg
gtgctctccatgatcagcatggggctcttctccatcgctcccctcatttatggcagcatg
gagatgttccctgcggcacagcaactctaccgccatggcaaggcctatcgcttcctgttt
ggtttttctgctgtctctgtcatgtacctggtgttggtactggcagtccaagttcatgcc
tggcaactgtactacagcaaaaaactcttagactcttggttcaccagcacacaggagaag
aaacggaaatga

DBGET integrated database retrieval system