KEGG   Mus musculus (mouse): 67770
Entry
67770             CDS       T01002                                 

Symbol
Caap1, 5830433M19Rik, AI536248, CAAP
Name
(RefSeq) caspase activity and apoptosis inhibitor 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CAAP1 NICE-1 C_GCAxxG_C_C SYCP2_SLD LCE SAP130_C
Other DBs
NCBI-GeneID: 67770
NCBI-ProteinID: NP_080644
MGI: 1915020
Ensembl: ENSMUSG00000028578
Vega: OTTMUSG00000007853
UniProt: Q8VDY9 Q3TUU0
Position
4; 4 C5
AA seq 356 aa
MTGKKSSREKRRKRSGQEAAASLAAPDLVPVLSGSAGGCGSGGCCGVAGGGTSVAGGAER
SERRKRRSTDSSSSVSGSLQQETKYLLPSLEKELFLAEHSDLEEGGLDLNVSLKPVSFYI
SDKKEMLQQCFCIIGEKKLQKMLPDVLKNCSVEEIKKLCQEQLELLSEKQILKILEGDNG
LDSDMEEEADDGCKVAPDLISQQDTCVDSTSSLRENKQPEVLESKQGKGEDSDVLSINAD
AYDSDIEGPSIDEAAAAATATPAATAVATAASEVPENTVQSEAGQIDDLERDIEKSVNEI
LGLAESSPKEPKVATLTVPPAEDVQPSAQQLELLELEMRARAIKALMKAGDIKKPV
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgacggggaagaagtcttcccgagaaaagcggcgcaagcggagcgggcaggaggcagcc
gcgtcgctcgcagccccggacctggtgcccgtgctgagcgggagcgcgggtgggtgcggg
agcggcggctgctgcggggtcgccggcggcgggacgagtgtggcgggcggcgcggaacga
agcgagcgccgaaagcggaggagcaccgattcgtcctccagcgtctcgggctccctgcag
caggaaaccaagtatcttttaccaagtctggaaaaagaattattcttggcagagcacagt
gatcttgaagaaggtggactggatctgaatgtctccttaaaacctgttagtttctatata
tcagacaaaaaggaaatgctgcagcaatgcttctgtatcataggagagaagaagttgcag
aagatgctccctgatgtactgaagaactgttcagtagaagaaattaaaaaactatgccag
gaacaattagagctcctgtctgaaaaacaaatcttgaagattcttgagggtgacaatggt
ttggactctgatatggaagaggaggcagatgatggctgtaaggtggcacctgatttaatc
agtcagcaagatacctgtgtagattctacttcatccctgagagagaacaaacaaccagaa
gttttggaatcaaaacaaggcaaaggggaagatagtgatgtactcagtataaatgcagat
gcttatgacagcgatatagaagggccaagcattgacgaagctgctgccgccgccaccgcc
acccctgctgctactgctgttgctactgctgcttccgaggtcccagaaaatacagtccag
agtgaagctggtcagatagatgacctggagagagatattgaaaaaagcgtgaatgagatt
ttgggactggcagagtctagcccaaaggaacccaaagtggccaccctgactgttcctcca
gcagaagacgttcagccttctgcgcagcaactggagcttctagaacttgaaatgagggca
agagcaattaaggctctcatgaaagctggtgatataaaaaagccagtgtag

DBGET integrated database retrieval system