KEGG   Mus musculus (mouse): 67775Help
Entry
67775             CDS       T01002                                 

Gene name
Rtp4, 5830458K16Rik, Ifrg28
Definition
(RefSeq) receptor transporter protein 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-3CxxC zf-3CxxC_2
Motif
Other DBs
NCBI-GeneID: 67775
NCBI-ProteinID: NP_075875
MGI: 1915025
Ensembl: ENSMUSG00000033355
Vega: OTTMUSG00000060333
UniProt: Q9ER80
Position
16; 16 B1
AA seq 249 aa AA seqDB search
MLFPDDFSTWEQTFQELMQEEKPGAKWSLHLDKNIVPDGAALGWRQHQQTVLGRFQCSRC
CRSWTSAQVMILCHMYPDTLKSQGQARMRIFGQKCQKCFGCQFETPKFSTEIIKRILNNL
VNYILQRYYGHRKIALTSNASLGEKVTLDGPHDTRNCEACSLNSHGRCALAHKVKPPRSP
SPLPKSSSPSKSCPPPPQTRNTDFGNKTFQDFGNRTFQGCREPPQREIEPPLFLFLSIAA
FALFSLFTR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccccgatgacttcagtacttgggagcagacatttcaagaactgatgcaggag
gagaagcccggggccaagtggagcctgcatttggataagaacattgtaccagatggtgca
gccctgggatggaggcagcaccagcagacagtgcttggcaggttccagtgttccagatgc
tgcagaagttggacctctgctcaggtgatgatcttgtgccacatgtacccggacactttg
aaatcgcagggccaggcacgcatgaggatctttggtcagaagtgccagaagtgttttgga
tgtcaatttgagactcccaagttctccacagagatcatcaaaagaattctgaataaccta
gttaattatattctgcagagatactatggacacaggaagatagcattgacctcgaatgca
tctttgggtgagaaggtgactttggatgggccccacgacacacgcaattgtgaggcatgc
agtctaaactctcatggaagatgtgcccttgcacacaaagtaaaaccacccagatctcca
tctccattaccaaagagttcctccccatcaaagagctgccctcctccgcctcagacccgg
aatacggattttgggaataaaacttttcaggattttgggaatagaacttttcagggatgc
agagagcccccccaacgtgaaatagagccaccactatttctgtttttgtctattgctgca
tttgccctttttagtcttttcactagataa

DBGET integrated database retrieval system