KEGG   Mus musculus (mouse): 67785Help
Entry
67785             CDS       T01002                                 

Gene name
Zmym4, 6330503C17Rik, AI480785, AW493829, CDIR, D630001M21, MYM, Zfp262, Znf262, mKIAA0425
Definition
(RefSeq) zinc finger, MYM-type 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3504 zf-FCS
Motif
Other DBs
NCBI-GeneID: 67785
NCBI-ProteinID: NP_001107871
MGI: 1915035
Ensembl: ENSMUSG00000042446
Vega: OTTMUSG00000009279
UniProt: A2A791
Position
4; 4 D2.2
AA seq 1549 aa AA seqDB search
MAEREVETGPRKRFEQKSDAVFDEIVENCGVMDTEMSEDTDHNLTPTLASMSYGMPNQTG
SENSLLDEDDYFLNSGDLAGIPVVSSDNEDEQDCSSKDNLVSSVHTDGSLEVERRAAHQE
SDNENEIQIQNQLKKDFPKQFDQVSVFKSIRKDFCLVRENSKETFSGKEKNRDLTYHERE
KRLDKPHKGLDSRLKSSFFDKAANQVEETLHTHLPQNPETNFRDSSYPFASKESIGSELG
NSFASNIRIKEEPLDDEYDRAVAPQQGLLDRVKDEPDNAQEYSHGQQQKTQEGELKISAV
FSVSGSPLAPQLTTGFQPSLASPGMNKMLPSVPATAVRVSCSGCKKILQKGQTAYQRKGS
TQLFCSTLCLTGYTVPPARPPPPLTKKTCSSCSKDILNPKDVISAQFENSTTSKDFCSQS
CLSTYELKKKPIVTINTNSISTKCSMCQKNAVIRHEVNYQNVVHKLCSDACFSKFRSANN
LTMNCCENCGGYCYSGSGQCHVLQIEGQSKKFCSSMCVTSYKQKSAKITPCALCKSLRSS
AEMIENTNSLGKTELFCSVNCLSAYRVKMVTSAGVQVQCNSCKTSAIPQYHLAMSDGSIR
NFCSYSCVVAFQNLFNKPTGMNSSVVPLSQGQVIVSIPTGSSASAGGGSTPAVSPTSINS
SAAAGLQRLAAQSQHVGFARSVVKLRCQHCNRLFATKPELLDYKGKMFQFCGKNCCDEYK
KINNVMAMCEYCKIEKIIKETVRFSGADKSFCSEGCKLLYKHDLGKRWGSHCKMCSYCLQ
TSPKLIQNNLGGKVEDFCCEECMSKYTVLFYQMAKCDGCKRQGKLSESLKWRGDIKHFCN
LLCILMFCHQQTVCDPPLQNNAVASISMVQAASAGPPSLRKDSTPVIANVVSLASAPAAQ
PTANTNSVLQGAVPTVTAKIIGDASTQTDALKLPPSQPPRLLKNKALLCKPITQTKATSC
KPHTQNKECQTDTPSEPQVMVVPVPVPVFVPIPLHLYTQYTPVPFGIPVPMPVPMFIPSS
MDNDEKATEGIEDIKEKLATHPFEADLLEMAEMIAEDEEKEKTLSQGESQTSEQELFLDT
KIFEKDQGSTYSGDLESEAVSTPHSWEEELNHYALKSNAVQDADSELKPFSKGETEQDLE
ADFPSESFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSVVPVEPRSLIQGALQGCS
VSGMTLKYMYGVNAWKNWVQWKNAKDEQGDLKCGGGELASASPCSDSLGSAQDHALSQES
SEQGCKARSVKLKEDILSCTFSELSLGLCQFIQEVRRPNGEKYDPDSILYLCLGIQQYLF
ENGRIDNIFTEPYSRFMIELTKLLKIWEPTILPNGYMFSRIEEEHLWECKQLGAYSPIVL
LNTLLFFNTKYFQLRNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQKPESEPDKV
TIGKRKRNEDDEAPVGVEMAENTDNPLRCPVRLYEFYLSKCSESVKQRSDVFYLQPERSC
VPNSPMWYSTFPIDPGTLDTMLTRILMVREVHEELAKAKSEDSDAELSD
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgggaggtggagaccggcccccgaaagaggtttgaacagaaaagtgatgca
gtttttgatgaaattgtagaaaactgtggtgtcatggatacagaaatgtctgaagataca
gaccacaacttaactcccacccttgccagcatgtcttatggaatgccgaatcaaacagga
tctgaaaattcattgctggatgaagatgattattttttgaactctggggatcttgcagga
attccagtcgttagtagtgacaatgaggatgaacaggattgtagttcaaaggacaacctt
gtttcttcagttcacactgatggtagtttggaagtagagagaagagctgctcatcaggaa
tcagacaatgaaaatgaaatacaaattcaaaatcagttaaaaaaagactttcctaaacag
tttgatcaggtttctgtctttaaatcaatacgaaaagatttttgtttagtgagagaaaac
agcaaagagacattttctggaaaggagaaaaatagagacctaacttatcatgaacgtgaa
aaacggttggataaaccccataaaggtttggattcaaggttgaaaagcagtttttttgat
aaagcagctaatcaagttgaagaaacattacatactcatttaccacaaaacccagaaaca
aactttagggactccagctacccatttgccagtaaagaatccattggttcggaactgggg
aattcgtttgcatcaaatattagaattaaagaagaacctttggatgatgagtatgacaga
gcagtggcgcctcagcagggactactagacagagttaaagacgaacctgacaatgctcaa
gagtatagtcatggccaacagcaaaaaactcaagagggggaactgaaaattagtgctgtg
ttttcagtcagtggcagtcctcttgctccacagttgactactggctttcagccttctctg
gcatcacctggcatgaataaaatgcttccttcagttccagccacagctgttcgagtttct
tgctctggttgtaaaaaaatcctccagaaggggcagactgcttatcagaggaaagggtct
actcagcttttctgctctaccctgtgcctcacgggatacacagttccacctgcccgccca
ccgcctcccctcaccaagaagacttgttcaagttgctcaaaagacattttaaatccaaag
gatgtgatcagtgcccagtttgaaaatagtaccaccagtaaggatttttgcagtcaatca
tgcttgtcaacatatgaactgaaaaaaaagcccattgttaccataaacacaaatagcatt
tcaaccaaatgcagcatgtgccagaagaacgctgtcattcgacatgaagttaattaccag
aacgtggttcataagctctgcagtgatgcctgtttttcgaagtttcgctctgctaacaac
ctcactatgaactgttgtgagaactgtgggggttactgttatagtggctctggacagtgc
catgtgctgcaaattgaggggcagtctaagaagttttgtagttcaatgtgtgtcacctca
tacaagcagaaatcagccaaaataacaccatgtgcgctttgcaaatcattgagatcctca
gcagaaatgattgagaataccaatagcttggggaagacagaacttttctgttctgttaat
tgcttatctgcttacagagttaaaatggttacttccgcaggtgtacaagttcagtgtaac
agttgtaaaacctcagcaatccctcagtatcatctagccatgtcagatggaagtatacgc
aacttctgcagctacagttgtgtggtagctttccagaatttgtttaacaaaccaactgga
atgaattcttcagtagtgcccttgtctcagggccaggtaatcgtgagcatccccacaggt
tcatcagcatctgcaggtggagggagtacacccgctgtgtcccccacctcgatcaacagc
tccgctgctgctgggctccagaggttggctgcccagtcccagcatgttgggtttgcccga
agtgtggtgaagcttaggtgtcaacattgtaaccgtctttttgccacaaagccagagctt
cttgactacaagggtaaaatgtttcagttctgtggcaagaattgttgtgatgaatataag
aaaatcaataatgtaatggcaatgtgtgaatactgtaaaattgagaaaattataaaggag
actgtgaggttctcaggtgctgacaagtcattttgtagtgaaggttgcaaattgctttat
aaacatgacttgggaaaacgctggggaagtcattgtaaaatgtgcagttattgtttacag
acatctcccaaactgatacagaataatttgggtggaaaggtggaagacttctgttgtgaa
gaatgcatgtctaagtatacagttttgttttatcagatggccaaatgtgatggttgcaag
agacagggtaaactcagtgaatcattgaaatggcgaggtgacataaaacacttttgtaac
ctgctttgcatcttgatgttctgtcatcagcaaactgtatgtgacccacctttacaaaac
aatgcagtagcaagtatttccatggttcaagctgcttctgcagggcctccgtccctcaga
aaagattcaactccagtcattgctaatgtggtatctttagcaagtgctcctgctgcccag
cccacagcaaacaccaacagcgtcttacaaggtgcagttccaacagttacagcgaaaatc
attggggatgcaagtactcaaacagatgccctgaaacttccaccttcccaacctccaagg
cttttgaagaacaaagctttattgtgcaaacccattacacagactaaagccacgtcatgt
aaaccacatactcaaaacaaagaatgccagacagacactccaagtgagccccaggttatg
gtggtaccagtccctgtgccagtgtttgttcccatacctcttcatctttacacccagtat
actcctgtcccctttgggattccagttcctatgcctgttcccatgtttattccatcctct
atggataatgatgagaaagcaactgagggcattgaagacattaaagagaaacttgccaca
catccgtttgaagcagatctccttgagatggcagaaatgattgcagaagatgaagagaag
gagaaaactttatcccagggagaatctcaaacttctgaacaagaactgtttctagacacc
aagatatttgaaaaagaccaaggaagtacatatagtggtgatcttgagtcagaagcagta
tcaactccacacagctgggaagaagagctgaatcattacgcattaaagtcgaatgctgtg
caagatgctgattcagaactgaaaccgttttcaaaaggggaaacagagcaggatctggag
gcagacttcccatcagaatcttttgacccacttaataaaggacaggggatccaggcacgt
tctcgaacaagacgaagacacagagatggattcccccagcccagacggcgagggaggaag
aagtctgtggtacctgtggaacccagaagtcttattcaaggagccttgcaagggtgctca
gtgtctggaatgacactgaagtatatgtatggggtaaatgcctggaagaactgggttcag
tggaaaaatgccaaggatgaacaaggagatctgaagtgcgggggaggtgaacttgcctct
gctagtccgtgttctgactccttaggaagtgctcaagaccatgccctctctcaagaatcc
tcagagcaaggctgtaaagcccgctctgtgaaactgaaggaagatattctgtcctgcact
ttttctgagttgagtttgggcttatgccagtttatccaagaggtgcggagaccaaatggt
gaaaagtatgacccagacagtatcttatacctgtgccttggaattcagcagtacctattt
gaaaatggtagaatagataacatttttacggagccctattccagatttatgattgaactt
accaaactcttgaaaatatgggaacctacaatacttcctaatggttacatgttctcccgc
attgaagaagagcatctgtgggagtgcaaacagctgggcgcttactcgcccattgtcctg
ttaaacaccctcctttttttcaataccaaatacttccaactaaggaatgttactgagcac
ttgaagctgtcctttgcccacgtgatgcgccggaccaggactctgaagtacagcaccaag
atgacgtacctgaggttcttcccgcctttacagaagccggagtcagagccagataaggta
actattggcaagaggaaacgaaatgaagacgacgaggccccagtgggagtggagatggca
gagaacactgacaacccgctgaggtgcccggttcggctttatgagttttacctgtcaaaa
tgttctgaaagtgtgaagcagaggagtgatgtgttctaccttcagccggagcgctcctgt
gttcctaacagtcccatgtggtactccacattccccatagaccctggaaccctggacacc
atgttgacgcgcattctcatggtgagggaggtacatgaagaacttgccaaagccaaatct
gaagactctgatgctgaattatcagattaa

DBGET integrated database retrieval system