KEGG   Mus musculus (mouse): 67788
Entry
67788             CDS       T01002                                 

Symbol
Sfr1, 6330577E15Rik, Meir5
Name
(RefSeq) SWI5 dependent recombination repair 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Mei5 Mei5_like Virul_Fac G10
Other DBs
NCBI-GeneID: 67788
NCBI-ProteinID: NP_080653
MGI: 1915038
Ensembl: ENSMUSG00000025066
UniProt: Q8BP27
Position
19 D1; 19
AA seq 319 aa
MAEEGNQEFTSKMENSSDSASTSPDAPQPSENPPSPPTSPAAPQTSENPPSPPTSPAVPQ
TRENPPSPPTSPAAPQPRENPPSPPTSPAAPQPRENPPSPPTSPAAPQPRENPPSPHSNS
SGKQPLSGTPKERLKKARSSSHSFCSVVKRMKVENDENNETLSEPGESSKEENCSKAQES
LKNKDSEPGEKSSEEKNTCESKSSDTGSSNALPKESENAIIREKLKQEKIRLIRQVEEKE
DLLRRLKLVKMYRIKNDVTELENLIKKWRKCGQRLLCELQSIMSEDEDEKLTLTELIDFY
GIDDNLLHYNRSEEEFTGV
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctgaggaaggaaatcaggagttcacttccaagatggaaaactcatcagattcagca
tcgacttcacctgatgctcctcagcccagtgagaatccaccatcaccaccgacttcacct
gccgctcctcagaccagtgagaatccaccatcaccaccgacttcacctgccgttcctcag
accagggagaatccaccatcaccaccgacttcacctgccgctcctcagcccagggagaat
ccaccatcaccaccgacttcacctgccgctcctcagcccagggagaatccaccatcaccc
ccgacttcacctgccgctcctcagcccagggagaatccaccatcaccccattcgaatagt
tcaggaaaacaacctctgagtggaacacctaaagaaaggttaaagaaagcaagatcttca
tctcattcattttgtagtgtggtgaagcgtatgaaggtagagaatgacgaaaataatgag
accctttcagaaccaggagaatcttcaaaggaagaaaattgttcaaaggcccaagaaagc
ttgaaaaacaaagacagtgagcctggagaaaagagctcagaggagaaaaacacgtgtgaa
tctaagtcgtcggatactgggtcatctaatgccctcccaaaggagtctgagaatgcgatc
attagagaaaaattaaaacaagaaaaaataagattgattaggcaggttgaagagaaggaa
gaccttcttcggaggttaaagttagtcaagatgtatagaataaagaacgacgtgactgag
ttagagaatctaataaagaagtggaggaagtgtggtcagcggctgctgtgtgagctgcag
tctatcatgtcggaggacgaggacgagaagctgacgctcaccgagctgatcgacttctac
gggatagatgacaacttgctgcactacaatcgaagtgaagaagagtttacaggggtgtga

DBGET integrated database retrieval system