KEGG   Mus musculus (house mouse): 67790
Entry
67790             CDS       T01002                                 
Symbol
Rab39b, 6330580M05Rik
Name
(RefSeq) RAB39B, member RAS oncogene family
  KO
K07925  Ras-related protein Rab-39B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04140  Autophagy - animal
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    67790 (Rab39b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    67790 (Rab39b)
   05022 Pathways of neurodegeneration - multiple diseases
    67790 (Rab39b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67790 (Rab39b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    67790 (Rab39b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Rab GTPases
    67790 (Rab39b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    67790 (Rab39b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU CENP-M AAA_22 DUF2381 TniB
Other DBs
NCBI-GeneID: 67790
NCBI-ProteinID: NP_780331
MGI: 1915040
Ensembl: ENSMUSG00000031202
UniProt: Q8BHC1 Q0PD14
Position
X:complement(74615651..74621837)
AA seq 213 aa
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKL
QIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVL
VGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEI
TIQEGWEGVKSGFVPNVVHSSEEVIKSERRCLC
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaggccatctggctgtaccagttccggctcattgtcatcggcgattccacggtgggc
aagtcctgcctgatccgccgcttcaccgagggccgctttgctcaggtttcagatcccacc
gtgggggtagattttttctcccgtttggtggagatcgagccaggaaaacgcatcaagctc
cagatctgggatacagcgggtcaagagaggttcagatccatcactcgcgcctactacagg
aattcagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccagaatgtc
catgagtggttagaagagaccaaagtacacgttcagccctaccaaattgtatttgttctg
gtgggtcacaagtgtgacctggatacacagaggcaagtgactcgccacgaggccgagaaa
ctggctgctgcatacggcatgaagtacattgagacgtcagcccgagatgccattaatgtg
gagaaagccttcacagacctgacaagagacatatatgagctggttaaaaggggggagatt
acaatccaggagggttgggaaggggtgaagagtggatttgtaccaaatgttgttcattct
tcagaagaggttatcaaatcagagaggagatgtttgtgctag

DBGET integrated database retrieval system