KEGG   Mus musculus (mouse): 67801Help
Entry
67801             CDS       T01002                                 

Gene name
Pllp, 0610010I06Rik, AV001002, Plapi, Tm4sf11
Definition
(RefSeq) plasma membrane proteolipid
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL Claudin_3
Motif
Other DBs
NCBI-GeneID: 67801
NCBI-ProteinID: NP_080661
MGI: 1915051
Ensembl: ENSMUSG00000031775
Vega: OTTMUSG00000061691
UniProt: Q9DCU2
Position
8; 8 C5
AA seq 182 aa AA seqDB search
MAEFPSKVSTRTSSPAQGVGASVSALRPDLGFVRSALGVLALLQLALGLLVWALIADTPY
HLYPAYGWVMFVAVFLWLVTIVFFIIYLFQLHMKLYMVPWPLVLLIFFVAATVLYITAFI
ACAAAVDLTSLRGSRPYNQRSAASFFACLVMIAYGVSAFFSFQAWRGVGSNAATSQMAGG
YS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcggagttcccgtcgaaagtgagcacgaggaccagcagccccgcgcagggcgtggga
gcctctgtgtctgcgctgcgaccggatctgggcttcgtgcgctccgctcttggggtgctc
gcgcttctgcagctggcactggggctgctggtgtgggccctgattgctgacaccccatac
catctgtatcctgcctatggctgggtcatgtttgtcgctgtcttcctctggctggtgaca
atcgtcttcttcatcatctacctgtttcaactgcacatgaagttgtacatggtgccctgg
ccgttggtgttactgatcttttttgtcgctgccacggttctctacattactgcctttatc
gcctgtgcagcggcggtcgatctgacatccctgaggggctcccggccatataaccagcgc
tcagctgcctctttctttgcttgtctggtgatgattgcctacggagtgagcgctttcttc
agcttccaggcctggcgaggagtgggtagcaacgcggccacgagtcagatggctgggggc
tactcctaa

DBGET integrated database retrieval system