KEGG   Mus musculus (house mouse): 67809
Entry
67809             CDS       T01002                                 
Symbol
Rmdn3, 1200015F23Rik, AI131757, Fam82a2, Ptpip51, RMD-3, Rmd3
Name
(RefSeq) regulator of microtubule dynamics 3
  KO
K23293  regulator of microtubule dynamics protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67809 (Rmdn3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    67809 (Rmdn3)
SSDB
Motif
Pfam: TPR_11
Other DBs
NCBI-GeneID: 67809
NCBI-ProteinID: NP_001028308
MGI: 1915059
Ensembl: ENSMUSG00000070730
UniProt: Q3UJU9
Position
2:complement(118967479..118987515)
AA seq 470 aa
MSRLGALGGSRAGLGLLLGTAAGLGFLCVLYSQRWKRTQRHGRSHSLPNSLDYAQASERG
RQVTQFRAIPGEAGDAAILPSLSQEGQEKVLDRLDFVLTSLMALRREVEELQRSLQGLAG
EIVGEVRSHIEENQRVARRRRFPFARERSDSTGSSSVYFTASSGAALTDAESEGGYTTAN
AESDYERDSDKESGDAEDEVSCETVRMGRKDSLDLDVEAASSPAAAALEEDDSSGREDVQ
LVLLQADELHQGSKQDKREGFQLLLNNKLAYGSRQDFLWRLARAYSDMSDLTEEESGKKS
YALNGKEEAEAALKKGDESAACHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQ
PEDPRGHFLLGRWCYQVSHLNWLEKKTATALFESPLSATVQDALQSFLKAEELQPGFSKA
GRVYISKCYRELGKNSEARKWMKLAQELPDVTNEDSAFQKDLEELEVILG
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtctagactgggggccctgggcggctcccgcgccgggttgggactgttacttggtact
gccgccggccttggattcctgtgcgtcctttacagccagcgatggaaacggacccagcgc
catggccggagtcacagtctgcccaactccctggactatgcgcaggcttcagagcgtgga
cgccaggtgacacagtttcgggctatcccaggtgaagctggagatgctgccatactgccc
agcctctcacaggaagggcaggagaaggtgctggaccgcctggactttgtgctgaccagt
cttatggcgctgcggcgcgaggtggaggagcttcagagaagcctgcaaggactagctggg
gagattgttggggaggtccgctctcatatagaagagaaccagagagtggcccggcggcgc
aggttcccttttgccagagagaggagtgactccacgggctccagctctgtctacttcacc
gcctcctcaggggctgcactcacagacgccgagagcgagggaggttatacaacagccaac
gcggagtctgattacgagcgggactccgacaaggagagtggagatgctgaggacgaagtg
agctgcgagaccgtgaggatggggaggaaggactctctggacctggatgtggaggcggcg
tccagtccggcggcggccgccttggaggaggatgactcctcaggccgagaggatgtgcag
ctggtcctgctgcaggccgatgagctgcaccagggcagcaagcaggacaagcgggaaggc
ttccagctgctgctcaacaataagctggcgtatggaagccgacaagactttctgtggcgc
ctggcccgggcctacagtgacatgtcagaccttactgaggaggagagcgggaagaagtcc
tatgccctaaatggaaaagaagaagcagaggctgctctgaagaaaggagatgagagtgct
gcgtgccacctgtggtatgcagtgctctgtggtcagctggctgagcatgagggcatctcg
aaacgcatccagagtggctttagcttcaaggaacatgtggacaaagccattgaacttcag
ccagaagaccccaggggtcactttcttcttggcaggtggtgctaccaggtttctcacttg
aactggttggaaaaaaaaacggctaccgccttgtttgaaagcccccttagtgctactgtg
caggacgctctgcagagtttccttaaggctgaggaactacagccaggattttcaaaagct
ggacgggtatatatttctaagtgctatagagaattaggaaaaaactctgaagctagaaag
tggatgaagctggctcaggaactgccagacgtcactaatgaggattcagctttccaaaaa
gacctggaagaactagaagtaattttaggataa

DBGET integrated database retrieval system