KEGG   Mus musculus (mouse): 67819
Entry
67819             CDS       T01002                                 

Gene name
Derl1, 1110021N07Rik, AI195141, AW551338, Derl, Derlin-1
Definition
(RefSeq) Der1-like domain family, member 1
  KO
K11519  Derlin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67819 (Derl1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    67819 (Derl1)
   05022 Pathways of neurodegeneration - multiple diseases
    67819 (Derl1)
SSDB
Motif
Pfam: DER1 DUF3341
Other DBs
NCBI-GeneID: 67819
NCBI-ProteinID: NP_077169
MGI: 1915069
Ensembl: ENSMUSG00000022365
UniProt: Q99J56
Position
15; 15 D1
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF
YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggggactggttcaggagcatcccggccatcacgcgctactggtttgct
gccaccgttgctgtccccttgatcggcaagctcggcatcatcagcccggcctacttcttc
ctctggcccgaagccttcctctatcgcttccagatatggaggccgttcactgccaccttt
tacttccccgtgggcccagggactggatttctgtatttggtcaatttatatttcttatat
cagtattctactcggcttgaagcaggagcttttgacgggaggccagcagactatttattc
atgcttctctttaactggatctgcatcgttattactggcttagcaatggatatgcagctg
ctgatgatccctctgatcatgtcagtgctctacgtctgggcccagctgaacagagacctg
atcgtgtcgttctggttcggaacgcgatttaaggcctgttacttaccttgggttatcctt
ggattcaactatatcattggaggctcggtgatcaatgagctcattggaaaccttgtcggc
catctttatttcttcctgatgttcagatacccaatggacttgggaggaaggaattttctg
tccacacctcagtttttgtaccgctggctacccagtaggagaggaggggtgtcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggcggaggcgggagacac
aactggggccagggcttccgacttggagaccagtga

DBGET integrated database retrieval system