KEGG   Mus musculus (mouse): 67826
Entry
67826             CDS       T01002                                 

Symbol
Snap47, 1110031B06Rik, SNA, SNAP-47
Name
(RefSeq) synaptosomal-associated protein, 47
  KO
K18212  synaptosomal-associated protein 47
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67826 (Snap47)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-47
    67826 (Snap47)
SSDB
Motif
Pfam: GRAM Imm3
Other DBs
NCBI-GeneID: 67826
NCBI-ProteinID: NP_653104
MGI: 1915076
Ensembl: ENSMUSG00000009894
Vega: OTTMUSG00000005789
UniProt: Q8R570
Position
11; 11 B1.3
AA seq 413 aa
MSSDMRVHSWSCSYYLDLEKQWVSGKLTLTPHSLKFIVEKTEEVLVGLPLSSIIEIRKES
SLFIFGAITVLEKGQTKHWFSSLQPSRNVVFNVIEHFWRELLLSQPGTAANIPSHVTRGQ
ELIGLMANSQKRMEDTAKDLQQQSEQLDSVLKGLEKMESDLDVADRLLTELETPSWWPFG
SKFWKMPAEENLKEGVSSTCEPFGKEGVVITVPAIISERAESHSKLGKLTVLVSALEIYD
SCSLLLHRFEKEDVDDIKVHSPYEVSIRQRFIGKPDVAYQLISAKMPEVIPILEVQFSSK
IELLEDALVLRNKVFASSAERHAASRPKGCTPHRELPTGGQEGEQLQLQKNLPLFSEGEA
QELTQILSKMKGLALDTEAELERQDAALDGITVAVDRATLNVDKQNRRMRKLM
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgagttctgatatgcgtgtccactcctggtcttgttcctactatctggaccttgagaag
caatgggtttctggaaaactgaccctgactcctcattcactgaagttcattgtggaaaaa
acagaagaggtccttgttggcctgcccctctccagcatcattgagatcaggaaagagtca
tctctctttatcttcggtgcgatcacagtcctggagaagggccagaccaagcactggttc
agctcactgcagcctagtcgaaatgtggtcttcaacgtcatcgaacatttctggagggag
ctgctactgtcccagccaggcactgctgccaacataccctcccacgtgaccaggggacag
gagctgataggactgatggcaaattcccagaaacgcatggaagacacagcgaaggatctc
cagcagcagagcgaacagctggacagcgtcctgaagggcctggagaagatggagtccgac
ctggacgtggctgacagattgctgacagaattggagacaccttcctggtggccttttggc
tctaagttttggaagatgccggcagaagaaaatctcaaggaaggtgtgtcttccacttgt
gagccctttggaaaggaaggggttgtgatcacggtccctgctattatttctgagagagca
gagtctcattccaagctgggaaagctcactgtcctggtctccgctctggaaatctatgac
tcctgctcgttgctcctgcacagatttgagaaggaagatgttgatgatatcaaggttcac
tctccttatgaggtcagcatacgccagcgcttcattgggaagccagacgtggcttaccag
ctgatatctgccaagatgccagaggtcattcccatcttagaagtgcagttcagcagcaag
attgagctcctggaagacgccttagtgctcaggaacaaggtctttgcttcctctgcagag
aggcatgcagcatccagaccgaagggctgcactccacaccgagagctgcccacaggagga
caggaaggcgagcagctgcagctgcagaagaacttgccactgttctctgagggggaagcc
caggagctgacacagatcctgagcaaaatgaagggactcgcactggacactgaggcagag
ctggaacgccaggatgcggctctggatggcatcaccgtagctgtggaccgggcaaccctg
aatgtggacaagcaaaaccggcgtatgagaaagctgatgtag

DBGET integrated database retrieval system