KEGG   Mus musculus (mouse): 67839
Entry
67839             CDS       T01002                                 

Gene name
Gpsm1, 1810037C22Rik, AW107933, Ag, Ags3
Definition
(RefSeq) G-protein signalling modulator 1 (AGS3-like, C. elegans)
  KO
K15839  G-protein signaling modulator 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    67839 (Gpsm1)
SSDB
Motif
Pfam: GoLoco TPR_12 TPR_1 TPR_7 TPR_2 TPR_8 TPR_10 TPR_MalT Rapsyn_N TPR_16 FliJ
Other DBs
NCBI-GeneID: 67839
NCBI-ProteinID: NP_700459
MGI: 1915089
Ensembl: ENSMUSG00000026930
Vega: OTTMUSG00000012734
UniProt: Q6IR34
Position
2; 2 A3
AA seq 673 aa
MASPAPPVAEELPGPASRRLYSRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGTE
DLKTLSAIYSQLGNAYFYLKEYARALQFHKHDLLLARTIGDRMGEAKASGNLGNTLKVLG
RFDEAIVCCQRHLDIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAAQDPGHLPPDVRE
TLHRASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIAKEFG
DKAAERRAYSNLGNAHIFLGRFDVAAEHYKKTLQLSRQLRDQAVEAQACYSLGNTYTLLQ
DYERAAEYHLRHLVIAQELADRVGEGRACWSLGNAYVSMGSPAQALTFAKKHLQISQEIG
DRNGELTARMNIAHLQLALGRLTSPAAAEKPDLAGYEAQGARPKRTQRLSAETWDLLRLP
LDREQNGETHHTGDWRGPGRDSLPLPMRSRKYQEGPDAIERRPREGSHSPLDSADVRVQV
PRTGIPRAPSSDEECFFDLLSKFQSSRMDDQRCPLEEGQAGAAEATAAPSVEDRAAQSSV
TASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITLNNVGHLRGDGDAQEPGDEFFNM
LIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGSPEQEASG
LPDPQQQCPPGAS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggcgagcccggccccgcccgtggccgaggagctcccgggcccggcctccaggcgcctc
tactccaggatggaggcctcctgtctagagctggccctggaaggggagcggctgtgcaag
gcgggggacttcaaggcaggtgtggctttcttcgaggctgctgtgcaggtgggcactgag
gacctgaagacactgagtgccatctacagccagctgggcaatgcctacttctacctgaag
gagtatgcccgggccctgcagttccacaaacatgacttgctgctggcacggaccattggt
gaccgcatgggggaggccaaggctagtgggaacctgggcaacacactcaaggtcctaggc
cgattcgatgaggcaatcgtctgctgccaacgacacttggacattgcccaggagcagggg
gacaaggttggggaggcgagagcactctacaacattggaaatgtgtaccacgccaagggc
aaacagctttcctggaatgctgcacaggaccccgggcacctgccacctgatgtccgcgag
acactgcacagggcctctgagttttatgagaggaacctgtctttggtgaaggaactaggc
gaccgggcggcccagggcagggcctatggcaacctgggtaacacccactacctactggga
aacttcacggaggccacaaccttccacaaagagcgcctggccatcgccaaggagtttggg
gacaaggcagctgagcggagggcctacagcaacctgggcaatgctcacatcttcttgggg
cgctttgatgtggctgctgaacattacaagaagacgctgcagctgtctcggcagctccgg
gaccaggcagtggaggctcaggcttgctacagcctgggcaacacctacacactgctacag
gactacgagcgtgctgctgagtaccacctgcggcacctagtcattgcccaggagctggct
gatagggtgggagagggccgagcatgctggagcctggggaacgcctatgtgtccatgggg
agccctgcacaggccttgacctttgccaagaaacatctgcagatctcccaggagattgga
gaccgaaacggagaactgacagcccgcatgaatattgcccacctgcagctggccctgggc
cggctgactagcccagcagcagcggagaagccagatctggctggctatgaggcacaagga
gcaagacccaaacggacacagaggctgagtgccgagacctgggacctgctgcggctcccc
ctggaccgggagcagaatggagagacccaccacacaggggactggaggggtccaggcagg
gactcgcttcccctccccatgaggagcaggaagtaccaggaaggtccagatgccattgag
aggagaccccgggagggtagtcactctccactggacagtgctgatgtaagggtacaggtg
cctcgtacgggtattcccagggccccgtcttctgacgaggagtgtttctttgacctgctg
agtaagttccagagcagtcgcatggatgaccagcgctgtcccctggaggaaggccaggct
ggggctgctgaggccacagctgccccatccgtggaggatagagcagctcagtcctccgtg
acagcttcaccacagacagaggagttctttgacctcattgccagctcccagagccgccgg
ctggacgaccagagggctagcgtaggcagcctgcctgggctacgcatcaccctcaacaat
gtggggcacctccgaggcgacggggacgcccaggagccgggggatgagtttttcaacatg
cttatcaaataccagtcctccaggattgatgaccagcgctgcccaccccctgatgtgctg
ccccgtggccctaccatgcctgatgaggatttcttcagccttatccagagggtgcaggct
aagcggatggatgagcagcgtgtggaccttgctgggagtccagagcaagaggccagtggg
ctgcctgatccccagcagcagtgtccaccgggtgccagctaa

DBGET integrated database retrieval system