KEGG   Mus musculus (mouse): 67841Help
Entry
67841             CDS       T01002                                 

Gene name
Atg3, 2610016C12Rik, APG3, Apg3l, Atg3l, PC3-96
Definition
(RefSeq) autophagy related 3
  KO
K08343  ubiquitin-like-conjugating enzyme ATG3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    67841 (Atg3)
   04136 Autophagy - other
    67841 (Atg3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    67841 (Atg3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67841 (Atg3)
   04121 Ubiquitin system [BR:mmu04121]
    67841 (Atg3)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    67841 (Atg3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    67841 (Atg3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   67841 (Atg3)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    67841 (Atg3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Autophagy_N Autophagy_act_C Autophagy_C
Motif
Other DBs
NCBI-GeneID: 67841
NCBI-ProteinID: NP_080678
MGI: 1915091
Ensembl: ENSMUSG00000022663
Vega: OTTMUSG00000025355
UniProt: Q9CPX6
Position
16; 16 B5
AA seq 314 aa AA seqDB search
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEE
LKVKAYLPTDKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGIT
EAVKEITLESKDSIKLQDCSALCDEEDEEDEGEAADMEEYEESGLLETDEATLDTRKIVE
ACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDH
VKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
IPTIEYDYTRHFTM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtgatcaacacggtgaagggaaaggctctggaagtggccgagtacctgacc
ccggtcctcaaggaatcaaaatttaaggaaacgggtgtaatcaccccagaagagtttgtg
gcagctggagatcacttagtccaccactgtccaacatggcaatgggctacaggggaagaa
ttgaaagtgaaggcatatcttccgacagacaaacaatttttggtaaccaaaaatgttcca
tgctacaagcggtgtaaacagatggagtattcggatgaattggaagctatcattgaagaa
gatgatggtgatgggggatgggtagatacatatcacaacacaggtattacaggaattact
gaagcagttaaggagattacactggaaagcaaggacagtataaaactccaagattgctca
gcactgtgtgatgaagaagacgaggaagatgaaggggaagctgcagacatggaagaatat
gaagagagtggattgttggaaacagatgaggctaccctagacacaaggaaaatagtggaa
gcctgcaaagctaaggctgacgctggaggtgaagatgctattttacaaacaagaacatac
gacctgtacatcacttacgacaaatattaccagacaccacggctatggttgtttggctat
gatgagcaacggcagcctttaacagttgagcacatgtatgaagacatcagtcaagatcat
gtgaagaaaacagtgaccattgaaaaccatcctcatctcccaccacctcctatgtgttca
gttcacccatgcaggcatgctgaagtgatgaagaaaattattgagacagttgcagaaggc
gggggagagcttggtgttcatatgtatcttttaatttttttgaaatttgttcaagctgtc
attccaacaatagaatatgactacacaagacacttcacaatgtag

DBGET integrated database retrieval system