KEGG   Mus musculus (mouse): 67844Help
Entry
67844             CDS       T01002                                 

Gene name
Rab32, 2810011A17Rik, AU022057
Definition
(RefSeq) RAB32, member RAS oncogene family
  KO
K07918  Ras-related protein Rab-32
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67844 (Rab32)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    67844 (Rab32)
Membrane trafficking [BR:mmu04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    67844 (Rab32)
   Mitochondrion
    67844 (Rab32)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab29/32/38 [OT]
    67844 (Rab32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA AAA_22 MMR_HSR1 AAA_7 PduV-EutP TsaE AAA_16 TniB Sigma54_activat
Motif
Other DBs
NCBI-GeneID: 67844
NCBI-ProteinID: NP_080681
MGI: 1915094
Ensembl: ENSMUSG00000019832
Vega: OTTMUSG00000027515
UniProt: Q9CZE3 Q0PD23
Position
10; 10 A1
AA seq 223 aa AA seqDB search
MAGEGLGQQGASATAAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDF
ALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKN
DLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINID
EATRFLVENMLANQQSFPSEEIDLDRIKLVEEPPTTKPRSQCC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgagggactagggcaacagggcgcgtcggccaccgcggcgccggagacccga
gagcacctctttaaggtgctggtcatcggcgagctcggcgtgggtaagacgagcatcatc
aagcgctacgtgcaccagctcttctcccagcactaccgcgccaccattggcgtggacttc
gccctcaaagttctcaactgggacagcaggacgctcgtgcgcctgcagctgtgggatatc
gcgggacaggaacggtttggcaacatgactcgagtatactataaggaagctcttggagca
tttgtagtctttgatatatcgagaagttctacatttgatgcagtcctaaaatggaaaaac
gatctggatagtaaagttcatcttcccaacggcagccccattcctgctgtcctcctagct
aacaaatgtgaccagaagaaggacaacagccagagtccttcccagatggaccagttttgt
aaagaccatggcttcactggatggtttgaaacctctgccaaggataatataaacatcgac
gaggccacccgcttcctagtggaaaacatgcttgcaaaccagcaaagttttcctagtgaa
gaaatcgacctggacagaattaaactggtagaggagccccccacaacaaagcccaggtcc
cagtgctgctga

DBGET integrated database retrieval system