KEGG   Mus musculus (mouse): 67849Help
Entry
67849             CDS       T01002                                 

Gene name
Cdca5, 2610036L13Rik, AL024086, AW536684, C85404
Definition
(RefSeq) cell division cycle associated 5
  KO
K17390  sororin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    67849 (Cdca5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    67849 (Cdca5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    67849 (Cdca5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sororin
Motif
Other DBs
NCBI-GeneID: 67849
NCBI-ProteinID: NP_080686
MGI: 1915099
Ensembl: ENSMUSG00000024791
Vega: OTTMUSG00000017313
UniProt: Q9CPY3
Position
19; 19 A
AA seq 264 aa AA seqDB search
MAERRTRSGGAAQRSGPRTSLTKPSKSSKRKSGSDLPNSFSEIWPRTTPAVPVRKAIVLK
KIVAHAVEVPDVHTVRRSPRISFILEKENNPPLKVPTKEDLFKTCSVPGTPSSTPVLYTQ
NVEPDSGEAELDSRDLEMSQKVRRSYSRLQSLGCASTSTPGRRSFFGFEGPDDLPGVSPV
VCSKLIETPKVPAKDLVPARTKDLVPDSTKDLVPARTLPGISPPVVKEKRKKKVPEILKS
ELDKWAVAMNAEFEAAEQFELLIE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcggcgaacacgatcaggaggggctgcccagcggtctgggcccaggacttca
cttactaagccttcgaagtcgtccaagcggaaatctggctcagatctcccgaactcgttc
tctgaaatctggccgaggacaactccagcggtcccagtcagaaaggccatcgtcttgaag
aagatcgtagctcatgcagtagaggtcccagatgtccacacggttcgaagaagtcctagg
atctcttttattttggaaaaagagaacaaccctccgctcaaggtacccacgaaagaagac
ctcttcaagacttgtagtgtccctggtactccctccagcacccccgtgctgtacactcag
aatgttgagcctgactctggagaagcagagctggacagcagagacctggaaatgtctcag
aaagtcaggcggtcgtacagtcggctacagagccttggttgtgcctcaacctccacccct
ggccgccgatccttctttggctttgagggacctgacgacttgcctggagtctcacctgtc
gtgtgttcaaagttaatcgagaccccaaaggtacctgcaaaggacttggttccggctaga
acgaaggacttggttccagatagtacgaaggacttggttccggctagaacgctccctgga
atctctcccccagttgtgaaagagaaacgaaagaagaaggttcctgaaatcctgaaatca
gagctggataagtgggctgtggccatgaatgctgaatttgaagctgccgagcagtttgag
cttctgattgaatga

DBGET integrated database retrieval system