KEGG   Mus musculus (mouse): 67856
Entry
67856             CDS       T01002                                 

Symbol
Echdc3, 2310005D12Rik, AI662097
Name
(RefSeq) enoyl Coenzyme A hydratase domain containing 3
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 67856
NCBI-ProteinID: NP_077170
MGI: 1915106
Ensembl: ENSMUSG00000039063
Vega: OTTMUSG00000011754
UniProt: Q9D7J9
Position
2:complement(6193276..6217805)
AA seq 300 aa
MAVVAGLRAFGVKWPSWLRRNPWAPLSAGFCSPGSAGPAGSESEPRLTSTRQQDGIRNIV
LSNPRRRNALSLAMLKSLRSDILHEAESEDLKVIIISAEGPVFSSGHDLKELTDAQGRDY
HAEVFQTCSEVMMLIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVG
LFCSTPAVALGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEAETMRIAKKI
SSLSRSVVALGKATFYKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKRKPIWSH
NT seq 903 nt   +upstreamnt  +downstreamnt
atggctgtggtcgcaggccttcgggcctttggggtgaagtggcccagctggctcaggcgc
aacccatgggcccctctctccgccggcttctgcagcccagggtcagcaggacctgcgggg
tcggagtcagagccaaggctcaccagcacgcgacagcaggacggaatcaggaacattgtc
ttaagcaatcccaggaggaggaatgcgctgtcactggccatgctgaaatctctccgaagt
gacattcttcacgaagctgaaagtgaagacctgaaagtcattataatttcagccgagggc
cctgtgttttcatctggacatgatttgaaagagctgacagatgcacaaggccgtgattat
cacgctgaggtatttcagacctgttctgaggtcatgatgctgatccggaaccacccggtc
cccatccttgccatggtcaatggcttggccacagctgcaggctgccagctcgtggccagc
tgtgatattgctgtggcaagtgacaagtcttcttttgcaactcctggagtgaatgttgga
cttttctgctccacccccgcggtcgccctggggagagcagtgcccagaaaggtggccctg
gagatgctctttactggggagcccatttctgcccaggaggccttgcgccatggccttatc
agcaaagtggtaccagaggaacagctggaggcagagaccatgagaatagcaaagaagatt
tcctctttgagccgctctgtggtggcgttgggcaaggccaccttttacaaacagctgcca
caagaccttagaaccgcctacttcctcgcctcccaggccatggtagacaacctggccttg
caggatgggcaggaaggaattgaagccttcatccagaagagaaagcccatctggtcacac
tga

DBGET integrated database retrieval system