KEGG   Mus musculus (mouse): 67860
Entry
67860             CDS       T01002                                 

Gene name
S100a16, 2300002L21Rik, AI325039, AI663996, DT1P1A7, S100F
Definition
(RefSeq) S100 calcium binding protein A16
  KO
K23768  protein S100-A16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    67860 (S100a16)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  S100 proteins
   67860 (S100a16)
Motif
Pfam: S_100 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_11 DUF5532 PDE4_UCR EF-hand_8
Other DBs
NCBI-GeneID: 67860
NCBI-ProteinID: NP_080692
MGI: 1915110
Ensembl: ENSMUSG00000074457
Vega: OTTMUSG00000021998
UniProt: Q9D708
Position
3; 3 F1
AA seq 124 aa
MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRELNHMLTDTGNRKAAD
KLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQQECQQESQQESQQESQ
QGSS
NT seq 375 nt   +upstreamnt  +downstreamnt
atggctgactgctatacagagctggagaaggcagttgttgtcctggtggaaaacttttat
aaatatgtatccaagcacagcctggtcaaaaacaagatcagcaagtccagcttccgaaag
atgctccagagagagttgaaccacatgctgacggacacagggaaccgaaaggcagctgac
aagctcatccagaacctggatgccaaccacgacgggcgcatctgctttgacgaatactgg
accatgattggtggaatcaccagccccatggccaacctcatccgccaacaggagtgccag
caggagagccagcaggagtgccagcaggagagccagcaggagagccagcaggagagccag
cagggcagcagctag

DBGET integrated database retrieval system