KEGG   Mus musculus (mouse): 67861Help
Entry
67861             CDS       T01002                                 

Gene name
Akr1b10, 2310005E10Rik, Akr1b16
Definition
(RefSeq) aldo-keto reductase family 1, member B10 (aldose reductase)
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu00561  Glycerolipid metabolism
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    67861 (Akr1b10)
   00051 Fructose and mannose metabolism
    67861 (Akr1b10)
   00052 Galactose metabolism
    67861 (Akr1b10)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    67861 (Akr1b10)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    67861 (Akr1b10)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldose reductase
     67861 (Akr1b10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 67861
NCBI-ProteinID: NP_765986
MGI: 1915111
Ensembl: ENSMUSG00000061758
Vega: OTTMUSG00000014789
UniProt: G5E895 Q8BIV6
Position
6; 6 B1
AA seq 316 aa AA seqDB search
MAAFVTLLTGAKMPIVGLGTWKSPPAKVREAVKVAIDAGYRHIDCAYVYQNESEVGEAIQ
EKIQEKAVKREDLFIVSKLWSTFFEKSLVKKAFQNTLSDLKLDYLDLYLIHWPQGFQSGN
VFLPTDDKGSILSSKYTFLDAWEAMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKP
VTNQVECHPYLTQEKLIQYCHSKGITITAYSPLGSPDRPSAKPEDPLLLEIPKIKEIAAK
HKRTAAQVLIRFHIERNVVVIPKSVTPSRIQENIQVFDFQLSEEDMAAILSFNRNWRACG
LFAASHNEDFPFHAEY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccgccttcgtgacgctccttaccggagccaagatgcccattgtgggcctgggcacc
tggaagtctcccccagctaaagtcagggaagctgtgaaggtggccattgatgctgggtat
cgccacattgattgtgcctatgtctatcagaatgagagcgaggtgggagaagccatccaa
gagaagatccaggagaaggctgtgaagcgggaggacctcttcatcgtcagcaagctgtgg
tccaccttctttgagaaaagcctggtgaagaaagccttccagaacaccctctcggatctg
aagcttgactacctggacctgtatctaatccactggccacagggatttcagtctggaaat
gtctttttacccacagatgataaaggcagtattctcagcagtaaatatacgttcttggat
gcttgggaggccatggaggaactggtggaccaggggctggtgaaagctctgggtgtctcc
aacttcaaccacttccagattgaaaggctcctgaacaagcctggactgaaacataagcca
gtgaccaaccaggtcgagtgtcacccttacctcacccaggaaaaactgatccagtactgt
cactccaagggcatcaccatcacagcctacagtcccctgggctccccagacaggcctagt
gccaaaccagaggaccccctattactggagattcccaagatcaaagagattgctgcaaag
cacaagaggactgcagcacaggttctgattcggttccatatagagaggaacgtggtggtg
atccccaagtctgtgacaccttctcgaatacaggagaacattcaggtcttcgacttccag
ttaagtgaggaggacatggccgccattctcagcttcaacaggaactggagggcctgtggc
ctgtttgcagcaagtcataacgaggacttccctttccatgcggaatactga

DBGET integrated database retrieval system