KEGG   Mus musculus (mouse): 67863
Entry
67863             CDS       T01002                                 

Gene name
Slc25a11, 2310022P18Rik, 2ox, 2oxoc
Definition
(RefSeq) solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11
  KO
K15104  solute carrier family 25 (mitochondrial oxoglutarate transporter), member 11
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    67863 (Slc25a11)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   67863 (Slc25a11)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 67863
NCBI-ProteinID: NP_077173
MGI: 1915113
Ensembl: ENSMUSG00000014606
Vega: OTTMUSG00000006069
UniProt: Q9CR62 Q5SX53
Position
11 B3; 11 43.21 cM
AA seq 314 aa
MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcggcgacggcgagtcctggggctggccggatggacgggaaaccccgtacctcccct
aagtctgtcaagttcctgtttgggggcctggctgggatgggtgctacagtctttgtgcag
cccctggacctggtgaagaaccggatgcagttgagtggtgaaggggccaagactcgagag
tacaaaaccagtttccatgccctcaccagcatcctgaagacagaaggcctgaagggcatt
tacactgggctgtcagctggtctactgcgccaggccacctacaccactactcgccttgga
atatatactgtgttgtttgagcgcctgactggggctgatggtacaccccctggctttctt
ctgaaagccctgattggcatgactgcaggtgcaactggtgcatttgtgggaacgccagct
gaggtggctctcatcaggatgactgctgatggtcggcttccagctgaccagcgccgtggc
tacaaaaatgtgtttaatgccctagttaggattgccagggaagaaggagtccccacactg
tggcggggctgcatccctaccatggctcgagctgtcgttgtcaatgccgcccagcttgcc
tcttactctcaatctaagcagttcttgctggactcaggctacttctctgacaatattctc
tgccacttctgcgccagcatgatcagtggcctcgttaccactgctgcttccatgcctgtg
gacatcgtcaaaactaggatccagaatatgcggatgattgatgggaagccagaatacaag
aatgggctggatgtgctgctgaaagtcgtccgctatgagggtttcttcagcctgtggaag
ggcttcacaccatactatgcccgactgggcccccacactgtcctcaccttcatcttcttg
gaacagatgaacaaggcctacaagcgtctcttcctcagtggctga

DBGET integrated database retrieval system